DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APC10 and zgc:158640

DIOPT Version :9

Sequence 1:NP_611223.4 Gene:APC10 / 36975 FlyBaseID:FBgn0034231 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001073534.1 Gene:zgc:158640 / 790918 ZFINID:ZDB-GENE-061215-15 Length:134 Species:Danio rerio


Alignment Length:103 Identity:26/103 - (25%)
Similarity:40/103 - (38%) Gaps:22/103 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYTDYKLDESYT 98
            |||.|.: ||.......|.:.|...:|:|.:.|..|....|:|.....|..:.|:       ||.
Zfish    10 GAQVVLA-SSGDENHPPENIIDGKKETFWITTGLFPQEFIIRFPDNMKILTVSIH-------SYN 66

  Fly    99 PSRISIR-------------SGTNFNDLQ-ELQVMDLT 122
            ..|:.|.             :||.|..:: .||..|::
Zfish    67 IKRLRIEKSTSDDGDHFEEVAGTEFEHIESSLQANDVS 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APC10NP_611223.4 ANAPC10 10..193 CDD:367420 26/103 (25%)
zgc:158640NP_001073534.1 F5_F8_type_C 17..123 CDD:279139 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.