DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APC10 and Anapc10

DIOPT Version :9

Sequence 1:NP_611223.4 Gene:APC10 / 36975 FlyBaseID:FBgn0034231 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001344163.1 Gene:Anapc10 / 68999 MGIID:1916249 Length:185 Species:Mus musculus


Alignment Length:186 Identity:106/186 - (56%)
Similarity:140/186 - (75%) Gaps:12/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PPSSEEDPLAEERLGFVREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHK 78
            ||.:  ||...||...|||:|:|||||||||||||||::|||:.::|||||||..||||||||.:
Mouse     8 PPGA--DPKQLERTATVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR 70

  Fly    79 RTNISQIYIYTDYKLDESYTPSRISIRSGTNFNDLQELQVMDLTEPTGWVQIPIKDGNVKSIRTF 143
            :|.:..:.||.|||.|||||||:||:|.|.||::|||::.::|.||:||:.:|:.|.:.|..|||
Mouse    71 KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTF 135

  Fly   144 MLQIAVISNHQNGRDTHMRQIRIHAPVE----GKHYPLELFGKFGTVDFQKFATIR 195
            |:||||::|||||||||||||:|:.|||    ||      |.:..|:||..:.:||
Mouse   136 MIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGK------FPRCTTIDFMMYRSIR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APC10NP_611223.4 ANAPC10 10..193 CDD:367420 104/182 (57%)
Anapc10NP_001344163.1 ANAPC10 4..183 CDD:367420 104/182 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846725
Domainoid 1 1.000 220 1.000 Domainoid score I2600
eggNOG 1 0.900 - - E1_COG5156
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32238
Inparanoid 1 1.050 225 1.000 Inparanoid score I3500
Isobase 1 0.950 - 0 Normalized mean entropy S1484
OMA 1 1.010 - - QHG54580
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004014
OrthoInspector 1 1.000 - - oto94491
orthoMCL 1 0.900 - - OOG6_102604
Panther 1 1.100 - - LDO PTHR12936
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R66
SonicParanoid 1 1.000 - - X3299
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.