DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APC10 and HSPB11

DIOPT Version :9

Sequence 1:NP_611223.4 Gene:APC10 / 36975 FlyBaseID:FBgn0034231 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001369190.1 Gene:HSPB11 / 51668 HGNCID:25019 Length:214 Species:Homo sapiens


Alignment Length:101 Identity:25/101 - (24%)
Similarity:42/101 - (41%) Gaps:16/101 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GAQAVWSLSSCK---PGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYTDYKLDE 95
            |::.:.:.||.:   |    |.:.|...:|:|.:.|..|....|.|||...|.::.|       :
Human    12 GSEVILATSSDEKHPP----ENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVI-------Q 65

  Fly    96 SYTPSRISIRSGTNFN--DLQELQVMDLTEPTGWVQ 129
            ||....:.|...|:..  |.::....||....|.:|
Human    66 SYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APC10NP_611223.4 ANAPC10 10..193 CDD:367420 25/101 (25%)
HSPB11NP_001369190.1 F5_F8_type_C 19..>90 CDD:395611 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.