DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APC10 and apc10

DIOPT Version :9

Sequence 1:NP_611223.4 Gene:APC10 / 36975 FlyBaseID:FBgn0034231 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_595803.1 Gene:apc10 / 2540307 PomBaseID:SPBC1A4.01 Length:189 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:66/143 - (46%)
Similarity:99/143 - (69%) Gaps:2/143 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GFVREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYTDYK 92
            ||| ::|..|.|:.||.|.||.:..:||:.:||||||||..||.::|:|.||.:|..:.:|..|.
pombe    22 GFV-DIGNLAQWTCSSEKSGFPIRLVRDDNIDTYWQSDGSQPHTIHIKFVKRVSIKYVSMYLQYT 85

  Fly    93 LDESYTPSRISIRSGTNFNDLQELQVMDLTEPTGWVQIPIKD-GNVKSIRTFMLQIAVISNHQNG 156
            ||||||||.:.|.:||.|.||:.:..:.:.||||||.:|:.| |....:...::||.:::|||:|
pombe    86 LDESYTPSTLRISAGTGFQDLEIVTTVQVEEPTGWVHVPVGDFGRNGLLDVHLIQIKILANHQSG 150

  Fly   157 RDTHMRQIRIHAP 169
            :|:|:|.|:|:||
pombe   151 KDSHVRLIKIYAP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APC10NP_611223.4 ANAPC10 10..193 CDD:367420 66/143 (46%)
apc10NP_595803.1 DOC1 1..189 CDD:227485 66/143 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1181
eggNOG 1 0.900 - - E1_COG5156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I1356
OMA 1 1.010 - - QHG54580
OrthoFinder 1 1.000 - - FOG0004014
OrthoInspector 1 1.000 - - oto101735
orthoMCL 1 0.900 - - OOG6_102604
Panther 1 1.100 - - LDO PTHR12936
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R66
SonicParanoid 1 1.000 - - X3299
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.