DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APC10 and apc10

DIOPT Version :10

Sequence 1:NP_611223.4 Gene:APC10 / 36975 FlyBaseID:FBgn0034231 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_595803.1 Gene:apc10 / 2540307 PomBaseID:SPBC1A4.01 Length:189 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:66/143 - (46%)
Similarity:99/143 - (69%) Gaps:2/143 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GFVREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYTDYK 92
            ||| ::|..|.|:.||.|.||.:..:||:.:||||||||..||.::|:|.||.:|..:.:|..|.
pombe    22 GFV-DIGNLAQWTCSSEKSGFPIRLVRDDNIDTYWQSDGSQPHTIHIKFVKRVSIKYVSMYLQYT 85

  Fly    93 LDESYTPSRISIRSGTNFNDLQELQVMDLTEPTGWVQIPIKD-GNVKSIRTFMLQIAVISNHQNG 156
            ||||||||.:.|.:||.|.||:.:..:.:.||||||.:|:.| |....:...::||.:::|||:|
pombe    86 LDESYTPSTLRISAGTGFQDLEIVTTVQVEEPTGWVHVPVGDFGRNGLLDVHLIQIKILANHQSG 150

  Fly   157 RDTHMRQIRIHAP 169
            :|:|:|.|:|:||
pombe   151 KDSHVRLIKIYAP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APC10NP_611223.4 ANAPC10 10..193 CDD:367420 66/143 (46%)
apc10NP_595803.1 DOC1 1..189 CDD:227485 66/143 (46%)

Return to query results.
Submit another query.