DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4853 and rasgef1a

DIOPT Version :9

Sequence 1:NP_611222.2 Gene:CG4853 / 36974 FlyBaseID:FBgn0034230 Length:709 Species:Drosophila melanogaster
Sequence 2:XP_012822158.1 Gene:rasgef1a / 734010 XenbaseID:XB-GENE-5739365 Length:485 Species:Xenopus tropicalis


Alignment Length:465 Identity:160/465 - (34%)
Similarity:252/465 - (54%) Gaps:66/465 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 PVYAKDIPKKGNLDSVVNLLINN----NTKDLRFAFLTTSRLFSPPHQLLSKI------------ 328
            |||.......|:|:.::..|:..    ..|...|.||.::|:|..|:::|:|:            
 Frog    40 PVYQDGSLVSGSLEVLIERLVPTLDYYPDKTYIFTFLLSARIFIHPYEILAKVGQMCIKQKQQLE 104

  Fly   329 ------IAKIDNEEENVLRLLNEWLDTCPGDFSHELLLQELENKRNVKGLAAFLDGIPQALAQKD 387
                  .||:.:....:::||.||.:|.|.||..|...:|::.             |.|.:.|.|
 Frog   105 SGSEADKAKLKSFAAKIIQLLREWTETFPFDFQDERARKEMKE-------------IAQRITQCD 156

  Fly   388 -ENGR-----SQL-NNLLTKQSSASSLGR-QSSIKSLKRFAANVYKT------DNVLNNCSSAFE 438
             |||.     ||: .|:|...|:...... :..|:........:.||      .::|:.||....
 Frog   157 EENGTIKKSISQMTQNVLVVLSTRGQFQEVREKIRQPVSDKGTILKTKPQSAQKDILSVCSDPLI 221

  Fly   439 LAHQLYAIEYAYLSQIRLEEFVEIL-EKDELKTCISQTKAGTLGSNCISQVT----IDSYVQWFN 498
            ||.||..||...|..|..|:.::|: ..|.|.           ...|.|.||    :::|..|||
 Frog   222 LAQQLTTIELERLGNIFPEDLMQIISHMDSLD-----------NHKCRSDVTKTYNLEAYDNWFN 275

  Fly   499 QLSYLTATEILKLGKKSQRAQMIDFWVETALECFNTGNFNSLMAILTALNLTAIARLKKTWAKVQ 563
            .||.|.||||.|:.||.||.::::|:::.|.||||.|||||:|||::.:||:.:|||||||:||:
 Frog   276 CLSMLVATEICKVVKKKQRTRVMEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVK 340

  Fly   564 TTKFEGLEHQMDPSSNFLNYRSTMKAAVWRSEREMANEIERAIIPFFSLFLKDLHAINESHETKL 628
            |.||:.|||.|||||||.|||:.::.|..||:...::. |:.:||.|:||:||:..:::.|..:|
 Frog   341 TAKFDVLEHHMDPSSNFCNYRTALQGATQRSQSANSSR-EKIVIPVFNLFIKDIFFLHKIHSNRL 404

  Fly   629 ANGYINFEKCLHLGTQLRNFGKWQRLDCPYEQLPSVVSYLLKAEVLSEDLLMKASYESEPPETGE 693
            .||:|||:|...:..|:.:|..|::::||||:...:.:|||...:.:|:.|..||:|:|.|:...
 Frog   405 PNGHINFKKFWEISRQIHDFLTWKQVECPYEKDKKIQTYLLTTPIYTEEALFLASFENEGPDNHM 469

  Fly   694 EKDHYKTLKA 703
            |||.:|||::
 Frog   470 EKDSWKTLRS 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4853NP_611222.2 RasGEF_N 288..365 CDD:279012 24/98 (24%)
RasGEF 438..638 CDD:279011 91/204 (45%)
rasgef1aXP_012822158.1 REM 51..168 CDD:100121 30/129 (23%)
RasGEF 218..465 CDD:214539 108/258 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9639
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D246323at33208
OrthoFinder 1 1.000 - - FOG0001827
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1189
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.