DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and RD21A

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_564497.1 Gene:RD21A / 841122 AraportID:AT1G47128 Length:462 Species:Arabidopsis thaliana


Alignment Length:275 Identity:112/275 - (40%)
Similarity:151/275 - (54%) Gaps:25/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 TFKQAVNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKF 220
            :::..:..|||||:.|:.|:..|.|.  |.|.....||:........:|::.|||:.|.|..||.
plant    92 SYRLGLTRFADLTNDE
YRSKYLGAKM--EKKGERRTSLRYEARVGDELPESIDWRKKGAVAEVKD 154

  Fly   221 QGTCGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLN-GCDGGFQEAAFCFIDEV 284
            ||.|||||||:|.||:||.....||.|..||||.||||    |...| ||:||..:.||.||.: 
plant   155 QGGCGSCWAFSTIGAVEGINQIVTGDLITLSEQELVDC----DTSYNEGCNGGLMDYAFEFIIK- 214

  Fly   285 QKGVSQEGAYPYIDNKGTCKYDGSKSGA---TLQGFAAIPPKDEEQLKKVVATLGPVACSVN-GL 345
            ..|:..:..|||....|||  |..:..|   |:..:..:|...||.|||.||. .|::.::. |.
plant   215 NGGIDTDKDYPYKGVDGTC--DQIRKNAKVVTIDSYEDVPTYSEESLKKAVAH-QPISIAIEAGG 276

  Fly   346 ETLKNYAGGIYNDDECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPR------ 404
            ...:.|..||: |..|.. :.:|.::.||||:|.|:|||||:|||..:|||.||.|:.|      
plant   277 RAFQLYDSGIF-DGSCGT-QLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSS 339

  Fly   405 GKNYCFIAEECSYPV 419
            ||  |.||.|.|||:
plant   340 GK--CGIAIEPSYPI 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 5/15 (33%)
Peptidase_C1A 204..418 CDD:239068 97/224 (43%)
RD21ANP_564497.1 Inhibitor_I29 50..107 CDD:214853 5/14 (36%)
Peptidase_C1 137..352 CDD:395062 98/226 (43%)
GRAN 376..432 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.