DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and AT1G29080

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_564320.1 Gene:AT1G29080 / 839783 AraportID:AT1G29080 Length:346 Species:Arabidopsis thaliana


Alignment Length:342 Identity:119/342 - (34%)
Similarity:176/342 - (51%) Gaps:34/342 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IAKAVPKVPLL--SNVQDF-GDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTF 157
            |::|..:|.|.  |::.|: ..::.|..:.|....::.|...........:|:.|   ..|..::
plant    20 ISEATSRVALYKPSSIVDYHQQWMIQFSRVYDDEFEKQLRLQVLTENLKFIESFN---NMGNQSY 81

  Fly   158 KQAVNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPAKP-----IPDAF----DWREHG 213
            |..||.|.|.|..|||:..|||:     .....:..::|| ..||     :.|..    |||..|
plant    82 KLGVNEFTDWTKEEFLATYTGLR-----GVNVTSPFEVVN-ETKPAWNWTVSDVLGTNKDWRNEG 140

  Fly   214 GVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAF 278
            .|||||.||.||.||||:...|:||.|....|:|.:||||.|:||...::   |||.||....||
plant   141 AVTPVKSQGECGGCWAFSAIAAVEGLTKIARGNLISLSEQQLLDCTREQN---NGCKGGTFVNAF 202

  Fly   279 CFIDEVQKGVSQEGAYPYIDNKGTCKYDGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVN 343
            .:|.: .:|:|.|..|||...:|.|: ..::....::||..:|..:|..|.:.|:. .|||.:::
plant   203 NYIIK-HRGISSENEYPYQVKEGPCR-SNARPAILIRGFENVPSNNERALLEAVSR-QPVAVAID 264

  Fly   344 GLET-LKNYAGGIYNDDECNKGEPNHSILVVGYG-SEKGQDYWIVKNSWDDTWGEKGYFRLPRG- 405
            ..|. ..:|:||:||...|.. ..||::.:|||| |.:|..||:.||||..||||.||.|:.|. 
plant   265 ASEAGFVHYSGGVYNARNCGT-SVNHAVTLVGYGTSPEGMKYWLAKNSWGKTWGENGYIRIRRDV 328

  Fly   406 ---KNYCFIAEECSYPV 419
               :..|.:|:..||||
plant   329 EWPQGMCGVAQYASYPV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 12/60 (20%)
Peptidase_C1A 204..418 CDD:239068 88/223 (39%)
AT1G29080NP_564320.1 PTZ00203 4..328 CDD:185513 113/323 (35%)
Inhibitor_I29 39..95 CDD:214853 12/58 (21%)
Peptidase_C1 135..345 CDD:278538 88/216 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.