DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and AT1G06260

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_563764.1 Gene:AT1G06260 / 837137 AraportID:AT1G06260 Length:343 Species:Arabidopsis thaliana


Alignment Length:325 Identity:126/325 - (38%)
Similarity:169/325 - (52%) Gaps:38/325 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 QDFGDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVH-TFKQAVNAFADLTHSEFL 173
            |.|..:|....|.|....:..|..|.:.|...|::     :...:| .||...|.|||:|:|||.
plant    41 QRFEKWLKTHSKLYGGRDEWMLRFGIYQSNVQLID-----YINSLHLPFKLTDNRFADMTNSEFK 100

  Fly   174 SQLTGLKRSPEAKARAAASLKL------VNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFAT 232
            :...||..|         ||:|      |..||..:|||.|||..|.|||::.||.||.||||:.
plant   101 AHFLGLNTS---------SLRLHKKQRPVCDPAGNVPDAVDWRTQGAVTPIRNQGKCGGCWAFSA 156

  Fly   233 TGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGL--NGCDGGFQEAAFCFIDEVQKGVSQEGAYP 295
            ..||||....|||:|.:||||.|:||    |.|.  .||.||..|.||.|| :...|::.|..||
plant   157 VAAIEGINKIKTGNLVSLSEQQLIDC----DVGTYNKGCSGGLMETAFEFI-KTNGGLATETDYP 216

  Fly   296 YIDNKGTCKYDGSKSG-ATLQGFAAIPPKDEEQLKKVVATLGPVACSVN-GLETLKNYAGGIYND 358
            |...:|||..:.||:. .|:||:..: .::|..| ::.|...||:..:: |....:.|:.|::. 
plant   217 YTGIEGTCDQEKSKNKVVTIQGYQKV-AQNEASL-QIAAAQQPVSVGIDAGGFIFQLYSSGVFT- 278

  Fly   359 DECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPRG----KNYCFIAEECSYPV 419
            :.|.. ..||.:.|||||.|..|.||||||||...|||:||.|:.||    ...|.||...|||:
plant   279 NYCGT-NLNHGVTVVGYGVEGDQKYWIVKNSWGTGWGEEGYIRMERGVSEDTGKCGIAMMASYPL 342

  Fly   420  419
            plant   343  342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 17/60 (28%)
Peptidase_C1A 204..418 CDD:239068 95/221 (43%)
AT1G06260NP_563764.1 Inhibitor_I29 43..98 CDD:214853 16/59 (27%)
Peptidase_C1 127..341 CDD:365882 95/222 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.