DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and RD21B

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_568620.1 Gene:RD21B / 834321 AraportID:AT5G43060 Length:463 Species:Arabidopsis thaliana


Alignment Length:300 Identity:116/300 - (38%)
Similarity:158/300 - (52%) Gaps:53/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 STKNLVEAGNAAFAQGVHTFKQAVNAFADLTHSEFLSQLTG-------LKRSPEAKARAAASLKL 195
            :||||             ::|..:..|||||:.|:.|...|       ||.|...:||...:|  
plant    89 NTKNL-------------SYKLGLTRFADLTNEEYRSMYLGAKPTKRVLKTSDRYQARVGDAL-- 138

  Fly   196 VNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGP 260
                    ||:.|||:.|.|..||.||:|||||||:|.||:||.....||.|.:||||.||||  
plant   139 --------PDSVDWRKEGAVADVKDQGSCGSCWAFSTIGAVEGINKIVTGDLISLSEQELVDC-- 193

  Fly   261 VEDFGLN-GCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKYDGSKSGA---TLQGFAAIP 321
              |...| ||:||..:.||.||.: ..|:..|..|||....|.|  |.::..|   |:..:..:|
plant   194 --DTSYNQGCNGGLMDYAFEFIIK-NGGIDTEADYPYKAADGRC--DQNRKNAKVVTIDSYEDVP 253

  Fly   322 PKDEEQLKKVVATLGPVACSVN-GLETLKNYAGGIYNDDECNKGEPNHSILVVGYGSEKGQDYWI 385
            ...|..|||.:|. .|::.::. |....:.|:.|:: |..|.. |.:|.::.||||:|.|:||||
plant   254 ENSEASLKKALAH-QPISVAIEAGGRAFQLYSSGVF-DGLCGT-ELDHGVVAVGYGTENGKDYWI 315

  Fly   386 VKNSWDDTWGEKGYFRL------PRGKNYCFIAEECSYPV 419
            |:|||.:.|||.||.::      |.||  |.||.|.|||:
plant   316 VRNSWGNRWGESGYIKMARNIEAPTGK--CGIAMEASYPI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 10/33 (30%)
Peptidase_C1A 204..418 CDD:239068 95/224 (42%)
RD21BNP_568620.1 Inhibitor_I29 50..109 CDD:214853 10/32 (31%)
Peptidase_C1 138..353 CDD:278538 97/236 (41%)
GRAN 377..433 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.