DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and AT4G11320

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001328659.1 Gene:AT4G11320 / 826734 AraportID:AT4G11320 Length:371 Species:Arabidopsis thaliana


Alignment Length:317 Identity:111/317 - (35%)
Similarity:150/317 - (47%) Gaps:22/317 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 FGDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQAVNAFADLTHSEFLSQL 176
            |..::.:.||.|.|.|::......|......:...||...    :::..:|.||||:..|:....
plant    56 FESWMVKHGKVYDSVAEKERRLTIFEDNLRFITNRNAENL----SYRLGLNRFADLSLHEYGEIC 116

  Fly   177 TGL-KRSPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHT 240
            .|. .|.|.......:|.:........:|.:.|||..|.||.||.||.|.|||||:|.||:||..
plant   117 HGADPRPPRNHVFMTSSNRYKTSDGDVLPKSVDWRNEGAVTEVKDQGLCRSCWAFSTVGAVEGLN 181

  Fly   241 FRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTC-- 303
            ...||.|..||||:|::|....    |||.||..|.|:.||.. ..|:..:..|||....|.|  
plant   182 KIVTGELVTLSEQDLINCNKEN----NGCGGGKVETAYEFIMN-NGGLGTDNDYPYKALNGVCEG 241

  Fly   304 KYDGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPNH 368
            :.........:.|:..:|..||..|.|.||.....|...:.....:.|..|:: |..|.. ..||
plant   242 RLKEDNKNVMIDGYENLPANDEAALMKAVAHQPVTAVVDSSSREFQLYESGVF-DGTCGT-NLNH 304

  Fly   369 SILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRL------PRGKNYCFIAEECSYPV 419
            .::|||||:|.|:||||||||..|||||.||.::      |||  .|.||...|||:
plant   305 GVVVVGYGTENGRDYWIVKNSRGDTWGEAGYMKMARNIANPRG--LCGIAMRASYPL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 14/59 (24%)
Peptidase_C1A 204..418 CDD:239068 90/221 (41%)
AT4G11320NP_001328659.1 Inhibitor_I29 56..111 CDD:214853 14/58 (24%)
Peptidase_C1 144..359 CDD:278538 91/223 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.