DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and AT3G19390

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_566633.1 Gene:AT3G19390 / 821473 AraportID:AT3G19390 Length:452 Species:Arabidopsis thaliana


Alignment Length:314 Identity:118/314 - (37%)
Similarity:159/314 - (50%) Gaps:25/314 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQAVNAFADLTHSEFLSQLTGL 179
            :|.::.|.|....::......|......||..::.   ...|::..:..|||||:.||  :...|
plant    46 WLVENRKNYNGLGEKERRFEIFKDNLKFVEEHSSI---PNRTYEVGLTRFADLTNDEF--RAIYL 105

  Fly   180 KRSPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKT 244
            :...|.........|.:......:|||.|||..|.|.|||.||:|||||||:..||:||....||
plant   106 RSKMERTRVPVKGEKYLYKVGDSLPDAIDWRAKGAVNPVKDQGSCGSCWAFSAIGAVEGINQIKT 170

  Fly   245 GSLPNLSEQNLVDCGPVEDFGLN-GCDGGFQEAAFCFIDEVQKGVSQEGAYPYI-DNKGTCKYDG 307
            |.|.:||||.||||    |...| ||.||..:.||.||.| ..|:..|..|||| .:...|..|.
plant   171 GELISLSEQELVDC----DTSYNDGCGGGLMDYAFKFIIE-NGGIDTEEDYPYIATDVNVCNSDK 230

  Fly   308 SKSG-ATLQGFAAIPPKDEEQLKKVVATLGPVACSVN-GLETLKNYAGGIYNDDECNKGEPNHSI 370
            ..:. .|:.|:..:|..||:.|||.:|. .|::.::. |....:.|..|::. ..|.. ..:|.:
plant   231 KNTRVVTIDGYEDVPQNDEKSLKKALAN-QPISVAIEAGGRAFQLYTSGVFT-GTCGT-SLDHGV 292

  Fly   371 LVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPR------GKNYCFIAEECSYP 418
            :.||||||.|||||||:|||...|||.|||:|.|      ||  |.:|...|||
plant   293 VAVGYGSEGGQDYWIVRNSWGSNWGESGYFKLERNIKESSGK--CGVAMMASYP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 12/56 (21%)
Peptidase_C1A 204..418 CDD:239068 99/223 (44%)
AT3G19390NP_566633.1 Inhibitor_I29 43..99 CDD:214853 12/55 (22%)
Peptidase_C1 129..345 CDD:278538 101/226 (45%)
GRAN 364..420 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.