DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and Ctso

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_038959660.1 Gene:Ctso / 684529 RGDID:1589156 Length:311 Species:Rattus norvegicus


Alignment Length:257 Identity:84/257 - (32%)
Similarity:134/257 - (52%) Gaps:15/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VNAFADLTHSEFLSQLTGLKR--SPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGT 223
            ||.|:.|...||.:...|.|.  :|...|:....:..|:||.:     ||||:...|..|:.|.|
  Rat    59 VNQFSYLFPEEFKALYLGSKPAWAPRYPAKGQTPIPNVSLPLR-----FDWRDKHVVNHVRNQKT 118

  Fly   224 CGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGV 288
            ||.||||:...|:|.....:...|..||.|.::||    .|...||.||....|..:::|.|..:
  Rat   119 CGGCWAFSVVSAVESAGAIQGKPLDYLSVQQVIDC----SFNNYGCRGGSPLGALSWLNETQLKL 179

  Fly   289 SQEGAYPYIDNKGTCKY-DGSKSGATLQGFAAIP-PKDEEQLKKVVATLGPVACSVNGLETLKNY 351
            ..:..||:....|.|:| ..|:||.:::||:|.. ...|:::.:.:.:.||:...|:.: :.::|
  Rat   180 VADSQYPFKAENGLCRYFPPSQSGVSVKGFSAYDFSNQEDEMARALLSFGPLVVIVDAV-SWQDY 243

  Fly   352 AGGIYNDDECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFIAE 413
            .|||. ...|:.||.||::|:.|:.......||:|:|||.::||.:||..:..|.|.|.||:
  Rat   244 LGGII-QHHCSSGEANHAVLITGFDKTGNTPYWMVRNSWGNSWGVEGYAYVKMGGNVCGIAD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 4/10 (40%)
Peptidase_C1A 204..418 CDD:239068 71/212 (33%)
CtsoXP_038959660.1 Peptidase_C1A 99..304 CDD:239068 71/215 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.