DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and Tpbpa

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_742070.1 Gene:Tpbpa / 64509 RGDID:621454 Length:124 Species:Rattus norvegicus


Alignment Length:126 Identity:25/126 - (19%)
Similarity:46/126 - (36%) Gaps:21/126 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 AKAVPKVPLLSNVQDFGDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQAV 161
            |..:|...|.:.:|:      |.||       ....:..:......|:..|:...|........:
  Rat    17 AAILPDTTLYAELQE------QKGK-------EGFRKAVWDEFMKTVKLYNSKSDQEEEELDIEM 68

  Fly   162 NAFADLTHSEFLSQLTGLKRSPEAK-ARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKFQ 221
            :|.::||..:|:..:|.:..|...: ...|.||       ..:|:..|..|.|...|::.|
  Rat    69 SALSELTDEDFMKIMTSISHSMSGEDENQAQSL-------GDVPEFEDLVESGDEIPIQEQ 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 9/59 (15%)
Peptidase_C1A 204..418 CDD:239068 6/18 (33%)
TpbpaNP_742070.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.