DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and ctsl

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_012821992.1 Gene:ctsl / 548464 XenbaseID:XB-GENE-5907229 Length:341 Species:Xenopus tropicalis


Alignment Length:313 Identity:114/313 - (36%)
Similarity:161/313 - (51%) Gaps:22/313 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 QDFGDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQAVNAFADLTHSEFLS 174
            |::..:.|:..|.|::.........|:.:|...|:..|....||:.:::.|:|.|||||.:|..|
 Frog    33 QEWNAWKSKYEKKYVTLDKELNRRKAWEATWEKVQKHNQLADQGLKSYRMAMNQFADLTDNERSS 97

  Fly   175 QLTGLKRSPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGT-CGSCWAFATTGAIEG 238
            :...|.|........|.|....::   .||...|||:...|||||.||| |||||||||.|.:|.
 Frog    98 KSCLLPREKSLNPVKAESYSYTSI---TIPKEVDWRKSNCVTPVKNQGTFCGSCWAFATVGVMES 159

  Fly   239 HTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTC 303
            ....:|..|.|||||.||||..:.:    ||.|||...|..::  .|.||.:...|.|...|.||
 Frog   160 RYCIRTKELLNLSEQQLVDCDEINE----GCCGGFPIKALEYV--AQHGVMRNKEYEYSQKKATC 218

  Fly   304 KYDGSKS-GATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPN 367
            :||..|: ...:..|..:|  .||.:...||..||:...:......:.|:.||:..| |.: .||
 Frog   219 EYDSDKAIHMNVSKFYILP--GEENMATSVAIEGPITVGIGVSSDFQLYSEGIFEGD-CAE-SPN 279

  Fly   368 HSILVVGYGS-------EKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFIAE 413
            |::::||||:       |:.:||||:||||...|||.||.::.|..|.|.|.|
 Frog   280 HAVIIVGYGTEHANDKEEEDKDYWIIKNSWGKEWGEDGYVKMKRNINQCSITE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 16/59 (27%)
Peptidase_C1A 204..418 CDD:239068 90/219 (41%)
ctslXP_012821992.1 Inhibitor_I29 35..94 CDD:214853 16/58 (28%)
Peptidase_C1A 124..335 CDD:239068 90/219 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.