DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and ctsz

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001006043.1 Gene:ctsz / 450022 ZFINID:ZDB-GENE-041010-139 Length:301 Species:Danio rerio


Alignment Length:294 Identity:84/294 - (28%)
Similarity:124/294 - (42%) Gaps:82/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LTGLKRSPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVK------FQGTCGSCWAFATTG 234
            |.|:|..|    |...|:.|     |.:|..:|||...||..|.      ....||||||..:|.
Zfish    36 LQGVKTGP----RPYESMNL-----KELPKEWDWRNIKGVNYVSTTRNQHIPQYCGSCWAHGSTS 91

  Fly   235 AIEGH-TFRKTGSLPN--LSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPY 296
            |:... ..::..:.|:  ||.||::|||   |.|  .|.||.....:.:..  .||:..|....|
Zfish    92 ALADRINIKRKAAWPSAYLSVQNVIDCG---DAG--SCSGGDHSGVWEYAH--NKGIPDETCNNY 149

  Fly   297 ---------IDNKGTC------------------KYDGSKSGATLQGFAAIPPKDEEQLKKVVAT 334
                     .:..|||                  .| ||.||.             :::|..:.:
Zfish   150 QAKDQDCKPFNQCGTCTTFGVCNIVKNFTLWKVGDY-GSASGL-------------DKMKAEIYS 200

  Fly   335 LGPVACSVNGLETLKNYAGGIYNDDECNKGEP--NHSILVVGYG-SEKGQDYWIVKNSWDDTWGE 396
            .||::|.:...:.|..|.||:|::   ...||  ||.:.|.|:| .|.|.::|:|:|||.:.|||
Zfish   201 GGPISCGIMATDKLDAYTGGLYSE---YVQEPYINHIVSVAGWGVDENGVEFWVVRNSWGEPWGE 262

  Fly   397 KGYFRL-------PRGKNY-CFIAEECSY--PVV 420
            ||:.|:       ..|..| ..|.|:|.|  |::
Zfish   263 KGWLRIVTSAYKGGSGSQYNLAIEEDCMYGDPIL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458
Peptidase_C1A 204..418 CDD:239068 75/262 (29%)
ctszNP_001006043.1 Peptidase_C1A_CathepsinX 54..295 CDD:239149 75/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.