DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and zgc:103438

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001006036.1 Gene:zgc:103438 / 450015 ZFINID:ZDB-GENE-041010-131 Length:311 Species:Danio rerio


Alignment Length:290 Identity:50/290 - (17%)
Similarity:90/290 - (31%) Gaps:119/290 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 FAQGVHTFK----QAVNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPAKPIPDAFD-W 209
            :.:|.:|.|    :||..|..:.|.:                      .::::|:..|.:.|: |
Zfish    20 YLKGTYTTKPDDDRAVPDFGKMYHVK----------------------GVISMPSYEIEEPFEAW 62

  Fly   210 RE----------HGGVTPVKFQGT---CGSCW------------AFATTGAIEGHTFRKTGSLPN 249
            .:          :.|.|.....|.   .|:.:            .|...|..| ...|...::|:
Zfish    63 YDFEGNRSRIDYYNGTTRTFLIGNDLDYGAIYQIKPVLPPSVIKCFQLKGTKE-EPIRPQSAMPD 126

  Fly   250 LSE---QNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKY-----D 306
            :.|   :.:.||                :.|.|   ||.|.|::.|     ..|.|.:.     :
Zfish   127 VQEFEFEKMEDC----------------KGAQC---EVWKTVTEAG-----HKKNTYRLWVTRPE 167

  Fly   307 GSKSGAT-----LQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEP 366
            |:.:.||     ::||                         |.|....|....|...|.|.:.||
Zfish   168 GNDAPATPHRFEMEGF-------------------------NSLLDSHNDKYSIEYSDFCTQSEP 207

  Fly   367 NHSILVVGYGSEK----GQDYWIVKNSWDD 392
            :......|:..|:    .:::.|:.|...|
Zfish   208 DVFTPPAGFTCEEFPDPPEEHQILANPIQD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 7/25 (28%)
Peptidase_C1A 204..418 CDD:239068 41/232 (18%)
zgc:103438NP_001006036.1 Inhibitor_I29 251..306 CDD:285458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.