DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsK2 and cer

DIOPT Version :10

Sequence 1:NP_725686.1 Gene:CtsK2 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster


Alignment Length:74 Identity:23/74 - (31%)
Similarity:38/74 - (51%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 QDFGDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQAVNAFADLTHSEFLS 174
            :::.::.|:..|.| .|.:..:....:|.:|..:|..|..|.:|..|:|..:|..||||..|| :
  Fly     7 EEWVEYKSKFDKNY-EAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF-A 69

  Fly   175 QLTGLKRSP 183
            |..|.|..|
  Fly    70 QRCGKKVPP 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsK2NP_725686.1 Inhibitor_I29 112..172 CDD:462410 17/59 (29%)
Peptidase_C1A 204..418 CDD:239068
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.