DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and CG6347

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster


Alignment Length:353 Identity:159/353 - (45%)
Similarity:219/353 - (62%) Gaps:23/353 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LQNVAG-AVQNAVGNIAKAVPKVPLLSNVQDFGDFLSQSGKTYLSAADRALHEGAFASTKNLVEA 145
            ||...| |:..||.  .:.:...|.|.:||:|.|||.|:||.| |..:|...|..||:..:|:..
  Fly     9 LQMTLGLALLGAVS--LQQLQSFPKLCDVQNFDDFLRQTGKVY-SDEERVYRESIFAAKMSLITL 70

  Fly   146 GNAAFAQGVHTFKQAVNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLV---NLPAKPIPDAF 207
            .|.....||..|:..||..||:|..| ::.|.|.|.|...:......:..|   |..:..:|:.|
  Fly    71 SNKNADNGVSGFRLGVNTLADMTRKE-IATLLGSKISEFGERYTNGHINFVTARNPASANLPEMF 134

  Fly   208 DWREHGGVTPVKFQGT-CGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDG 271
            ||||.|||||..|||. ||:||:||||||:|||.||:||.|.:||:||||||  .:|:|..||||
  Fly   135 DWREKGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDC--ADDYGNMGCDG 197

  Fly   272 GFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKYDGS------KSGATLQGFAAIPPKDEEQLKK 330
            ||||..|.:|.:  .||:....|||...:..|:.:.:      :|...::.:|.|.|.|||::|:
  Fly   198 GFQEYGFEYIRD--HGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATITPGDEEKMKE 260

  Fly   331 VVATLGPVACSVNGLETL--KNYAGGIYNDDECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDT 393
            |:|||||:|||:|. :|:  :.|:||||.|:|||:||.|||:.|||||:|.|:||||:|||:...
  Fly   261 VIATLGPLACSMNA-DTISFEQYSGGIYEDEECNQGELNHSVTVVGYGTENGRDYWIIKNSYSQN 324

  Fly   394 WGEKGYFRLPRGK-NYCFIAEECSYPVV 420
            |||.|:.|:.|.. .:|.||.|||||::
  Fly   325 WGEGGFMRILRNAGGFCGIASECSYPIL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 23/59 (39%)
Peptidase_C1A 204..418 CDD:239068 117/223 (52%)
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 24/60 (40%)
Peptidase_C1A 131..350 CDD:239068 117/223 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452942
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 1 1.000 - - FOG0019589
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.