DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and ctss2.2

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_009290599.1 Gene:ctss2.2 / 337572 ZFINID:ZDB-GENE-050626-55 Length:337 Species:Danio rerio


Alignment Length:281 Identity:113/281 - (40%)
Similarity:163/281 - (58%) Gaps:9/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LVEAGNAAFAQGVHTFKQAVNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPAKPIPDA 206
            |:...|...:.|:|::..|:|..||:|..|.| |...:.|.|....|..|  :.|:.....:||.
Zfish    64 LIAIHNLEASMGMHSYDLAINHMADMTTEE
IL-QTLAVTRVPPGFKRPTA--EYVSSSFAVVPDT 125

  Fly   207 FDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDG 271
            .|||:.|.||.||.||.|||||||::.||:||...:.||.|.:||.||||||.  ..:|..||:|
Zfish   126 LDWRDKGYVTSVKNQGACGSCWAFSSVGALEGQLMKTTGKLVDLSPQNLVDCS--SKYGNLGCNG 188

  Fly   272 GFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKYDGSKSGATLQGFAAIPPKDEEQLKKVVATLG 336
            |:...||.::.: ..|:..|.:|||...:|:|:||.|:..|....:..:...||:.||:.:|.:|
Zfish   189 GYMSQAFQYVID-NGGIDSESSYPYQGTQGSCRYDPSQRAANCTSYKFVSQGDEQALKEALANIG 252

  Fly   337 PVACSVNGLE-TLKNYAGGIYNDDECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYF 400
            ||:.:::... ....|..|:|:|..|.: :.||.:|.||||:..|||||:|||||...:|:.||.
Zfish   253 PVSVAIDATRPQFIFYRSGVYDDPSCTQ-KVNHGVLAVGYGTLSGQDYWLVKNSWGAGFGDGGYI 316

  Fly   401 RLPRGK-NYCFIAEECSYPVV 420
            |:.|.| |.|.||.|..||:|
Zfish   317 RIARNKNNMCGIASEACYPIV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 9/29 (31%)
Peptidase_C1A 204..418 CDD:239068 93/215 (43%)
ctss2.2XP_009290599.1 Inhibitor_I29 34..93 CDD:214853 9/28 (32%)
Peptidase_C1 122..336 CDD:278538 94/217 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.