DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and CtsB1

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster


Alignment Length:256 Identity:72/256 - (28%)
Similarity:113/256 - (44%) Gaps:50/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 IPDAFD----WREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPN--LSEQNLVDCGPV 261
            :|:.||    |.....:..::.||:|||||||....|:.......:|...|  .|..:||.|...
  Fly    87 LPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHT 151

  Fly   262 EDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKYD---------GSK-------- 309
            ..|   ||:|||..||:.:  ..:||:...|  ||..|:|...|:         |::        
  Fly   152 CGF---GCNGGFPGAAWSY--WTRKGIVSGG--PYGSNQGCRPYEISPCEHHVNGTRPPCAHGGR 209

  Fly   310 ----SGATLQGFAAIPPKDE-------------EQLKKVVATLGPVACSVNGLETLKNYAGGIYN 357
                |.....|:.....||:             .::::.:.|.|||..:....|.|..|..|:| 
  Fly   210 TPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVY- 273

  Fly   358 DDECNKGEPNHSILVVGYG--SEKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFIAEECS 416
            ..|..|....|:|.::|:|  .|:...||::.|||:..||:.|:||:.||:::|.|....|
  Fly   274 QHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSIS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458
Peptidase_C1A 204..418 CDD:239068 72/255 (28%)
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 72/255 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452945
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.