DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and si:dkey-239j18.2

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001274132.1 Gene:si:dkey-239j18.2 / 321853 ZFINID:ZDB-GENE-121214-52 Length:335 Species:Danio rerio


Alignment Length:335 Identity:130/335 - (38%)
Similarity:188/335 - (56%) Gaps:28/335 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 AVPKVPLLSNVQD-FGDFLSQSGKTY---LSAADRALHEGAFASTKNL--VEAGNAAFAQGVHTF 157
            |.|.:.:  .:.| :..:.||.||:|   :....|.:.|      :||  :|..|..::.|.|||
Zfish    16 AAPSIDI--QLDDHWNSWKSQHGKSYHEDVEVGRRMIWE------ENLRKIEQHNFEYSLGNHTF 72

  Fly   158 KQAVNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKFQG 222
            |..:|.|.|:|:.||...:.|.|..|...::....::.....|   |...|||:.|.|||||.|.
Zfish    73 KMGMNQFGDMTNEEFRQAMNGYKHDPNRTSQGPLFMEPKFFAA---PQQVDWRQRGYVTPVKDQK 134

  Fly   223 TCGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKG 287
            .|||||:|::|||:||..|||||.|.::||||||||.  ...|..||:||..:.||.::.| .||
Zfish   135 QCGSCWSFSSTGALEGQLFRKTGKLISMSEQNLVDCS--RPHGNQGCNGGLMDQAFQYVKE-NKG 196

  Fly   288 VSQEGAYPYIDNKG-TCKYDGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGL-ETLKN 350
            :..|.:|||:.... .|:||...:.|.:.||..||..:|..|...||.:|||:.:::.. ::|:.
Zfish   197 LDSEQSYPYLARDDLPCRYDPRFNVAKITGFVDIPKGNELALMNAVAAVGPVSVAIDASHQSLQF 261

  Fly   351 YAGGIYNDDECNKGEPNHSILVVGYGSE----KGQDYWIVKNSWDDTWGEKGYFRLPRGK-NYCF 410
            |..|||.:..|. .:.:|::||||||.:    .|..||||||||.|.||:|||..:.:.| |:|.
Zfish   262 YQSGIYYERACT-SQLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCG 325

  Fly   411 IAEECSYPVV 420
            ||...|||::
Zfish   326 IATMASYPLM 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 20/64 (31%)
Peptidase_C1A 204..418 CDD:239068 99/220 (45%)
si:dkey-239j18.2NP_001274132.1 Inhibitor_I29 28..86 CDD:214853 20/63 (32%)
Peptidase_C1 115..334 CDD:278538 101/225 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.