DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsK2 and TINAG

DIOPT Version :10

Sequence 1:NP_725686.1 Gene:CtsK2 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_055279.3 Gene:TINAG / 27283 HGNCID:14599 Length:476 Species:Homo sapiens


Alignment Length:263 Identity:69/263 - (26%)
Similarity:106/263 - (40%) Gaps:69/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 NLPA-KPIPDAF-------DWREHGGVTPVKFQGTCGSCWAFATTG------AIEGHTFRKTGSL 247
            :||| ..:|:.|       .| .||.:.    |..|.:.|||:|..      ||:.    |....
Human   210 SLPATTDLPEFFVASYKWPGW-THGPLD----QKNCAASWAFSTASVAADRIAIQS----KGRYT 265

  Fly   248 PNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYI--------------- 297
            .|||.|||:.|...   ..:||:.|..:.|:.::.  ::|:.....||..               
Human   266 ANLSPQNLISCCAK---NRHGCNSGSIDRAWWYLR--KRGLVSHACYPLFKDQNATNNGCAMASR 325

  Fly   298 -DNKG------TCKYDGSKSGATLQGFAAIPP----KDEEQLKKVVATLGPVACSVNGLETLKNY 351
             |.:|      .|..:..||....|   ..||    .:|.::.|.:...|||...:...|...:|
Human   326 SDGRGKRHATKPCPNNVEKSNRIYQ---CSPPYRVSSNETEIMKEIMQNGPVQAIMQVREDFFHY 387

  Fly   352 AGGIY-------NDDECNKGEPNHSILVVGYGSEKG-----QDYWIVKNSWDDTWGEKGYFRLPR 404
            ..|||       .:.|..:....|::.:.|:|:.:|     :.:||..|||..:|||.||||:.|
Human   388 KTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGTLRGAQGQKEKFWIAANSWGKSWGENGYFRILR 452

  Fly   405 GKN 407
            |.|
Human   453 GVN 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsK2NP_725686.1 Inhibitor_I29 112..172 CDD:462410
Peptidase_C1A 204..418 CDD:239068 66/255 (26%)
TINAGNP_055279.3 Somatomedin_B 61..106 CDD:470596
VWC 120..>154 CDD:450195
Peptidase_C1A_CathepsinB 218..466 CDD:239111 66/255 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.