DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and Ctsj

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001343220.1 Gene:Ctsj / 26898 MGIID:1349426 Length:334 Species:Mus musculus


Alignment Length:319 Identity:115/319 - (36%)
Similarity:168/319 - (52%) Gaps:26/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DFGDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQAVNAFADLTHSEFLSQ 175
            ::.|:.::..|:| |..:.||....:.....:::..|...:.|.:.|...:|.|.|.|..||...
Mouse    28 EWKDWKTKYAKSY-SPKEEALRRAVWEENMRMIKLHNKENSLGKNNFTMKMNKFGDQTSEEFRKS 91

  Fly   176 LTGL-----KRSPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGA 235
            :..:     ...|.|:...:..|          ||..||||.|.||||:.||.||||||||..||
Mouse    92 IDNIPIPAAMTDPHAQNHVSIGL----------PDYKDWREEGYVTPVRNQGKCGSCWAFAAAGA 146

  Fly   236 IEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNK 300
            |||..|.|||:|..||.|||:||.  :..|..||..|....||.::.: .||:..|..|||....
Mouse   147 IEGQMFWKTGNLTPLSVQNLLDCS--KTVGNKGCQSGTAHQAFEYVLK-NKGLEAEATYPYEGKD 208

  Fly   301 GTCKYDGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGL-ETLKNYAGGIYNDDECNKG 364
            |.|:|....:.|.:..:..:|| :|..|...||::|||:.:::.. ::.:.|.||||.:..|:..
Mouse   209 GPCRYRSENASANITDYVNLPP-NELYLWVAVASIGPVSAAIDASHDSFRFYNGGIYYEPNCSSY 272

  Fly   365 EPNHSILVVGYGSE----KGQDYWIVKNSWDDTWGEKGYFRLPRG-KNYCFIAEECSYP 418
            ..||::||||||||    .|.:||::||||.:.||..||.::.:. .|:|.||...|||
Mouse   273 FVNHAVLVVGYGSEGDVKDGNNYWLIKNSWGEEWGMNGYMQIAKDHNNHCGIASLASYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 13/59 (22%)
Peptidase_C1A 204..418 CDD:239068 95/219 (43%)
CtsjNP_001343220.1 Inhibitor_I29 29..87 CDD:214853 13/58 (22%)
Peptidase_C1 114..331 CDD:306594 96/230 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.