DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and Ctsz

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_899159.1 Gene:Ctsz / 252929 RGDID:708479 Length:306 Species:Rattus norvegicus


Alignment Length:254 Identity:76/254 - (29%)
Similarity:116/254 - (45%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 IPDAFDWREHGGVTPVKFQGT------CGSCWAFATTGAIEGH-TFRKTGSLPN--LSEQNLVDC 258
            :|..:|||...||........      ||||||..:|.|:... ..::.|:.|:  ||.||::||
  Rat    64 LPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLLSVQNVIDC 128

  Fly   259 GPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPY---------IDNKGTCKYDGSKSGATL 314
            |     ....|:||.....:.:..  :.|:..|....|         .:..|||  ...|...|:
  Rat   129 G-----NAGSCEGGNDLPVWEYAH--KHGIPDETCNNYQAKDQECDKFNQCGTC--TEFKECHTI 184

  Fly   315 QGFAAIPPKD-------EEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPNHSILV 372
            |.:......|       |:.:.::.|. ||::|.:...|.:.||.||||.:.: |:...||.|.|
  Rat   185 QNYTLWRVGDYGSLSGREKMMAEIYAN-GPISCGIMATERMSNYTGGIYTEYQ-NQAIINHIISV 247

  Fly   373 VGYG-SEKGQDYWIVKNSWDDTWGEKGYFRL-------PRGKNYCFIAEE-CSY--PVV 420
            .|:| |..|.:||||:|||.:.|||:|:.|:       ..|.:|....|| |::  |:|
  Rat   248 AGWGVSNDGIEYWIVRNSWGEPWGERGWMRIVTSTYKGGTGSSYNLAIEEACTFGDPIV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458
Peptidase_C1A 204..418 CDD:239068 74/249 (30%)
CtszNP_899159.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 74/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.