Sequence 1: | NP_725686.1 | Gene: | CG4847 / 36973 | FlyBaseID: | FBgn0034229 | Length: | 420 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001293573.1 | Gene: | C32B5.7 / 183111 | WormBaseID: | WBGene00016300 | Length: | 234 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 67/197 - (34%) |
---|---|---|---|
Similarity: | 95/197 - (48%) | Gaps: | 24/197 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 201 KPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFG 265
Fly 266 LNGC----DGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKG-TCKYDGSKSGATLQGFAAIPPKDE 325
Fly 326 EQLKKVVATLGPVACSVNGLETLKNYAGGIYN--DDECNKGEPNHSILVVGYGSEKGQDYWIVKN 388
Fly 389 SW 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4847 | NP_725686.1 | Inhibitor_I29 | 112..172 | CDD:285458 | |
Peptidase_C1A | 204..418 | CDD:239068 | 65/194 (34%) | ||
C32B5.7 | NP_001293573.1 | Peptidase_C1A | 56..234 | CDD:239068 | 65/191 (34%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1275401at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |