DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and C32B5.7

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001293573.1 Gene:C32B5.7 / 183111 WormBaseID:WBGene00016300 Length:234 Species:Caenorhabditis elegans


Alignment Length:197 Identity:67/197 - (34%)
Similarity:95/197 - (48%) Gaps:24/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 KPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFG 265
            ||.   .|||:.|.|.|||.||.|.:.:|||...|||.......|.|.:.|||.::||       
 Worm    53 KPF---LDWRDEGVVGPVKDQGNCNASYAFAAISAIESMYAIANGQLLSFSEQQIIDC------- 107

  Fly   266 LNGC----DGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKG-TCKYDGSKSGATLQGFAAIPPKDE 325
            |.||    |   ...|..:::  :||:.....||::..|. .|:||..|:...|..  .....||
 Worm   108 LGGCAIESD---PMMAMTYLE--RKGIETYTDYPFVGKKNEKCEYDSKKAYLILDD--TYDMSDE 165

  Fly   326 EQLKKVVATLGPVACSVNGLETLKNYAGGIYN--DDECNKGEPNHSILVVGYGSEKGQDYWIVKN 388
            ......:...||...::|...:..||..||||  ::||.......::.:||||::|||:|||||.
 Worm   166 SLALVFIDERGPGLFTMNTPPSFFNYKSGIYNPTEEECKSTNEKRALTIVGYGNDKGQNYWIVKG 230

  Fly   389 SW 390
            |:
 Worm   231 SF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458
Peptidase_C1A 204..418 CDD:239068 65/194 (34%)
C32B5.7NP_001293573.1 Peptidase_C1A 56..234 CDD:239068 65/191 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.