DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and cpr-6

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_741818.1 Gene:cpr-6 / 180931 WormBaseID:WBGene00000786 Length:379 Species:Caenorhabditis elegans


Alignment Length:253 Identity:75/253 - (29%)
Similarity:112/253 - (44%) Gaps:53/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 IPDAFD----WREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFR----KTGSLP-NLSEQNLVDC 258
            ||::||    |.:...:..::.|.:|||||||   ||:|..:.|    ..|.|. .||..:|:.|
 Worm   105 IPESFDSRDNWPKCDSIKVIRDQSSCGSCWAF---GAVEAMSDRICIASHGELQVTLSADDLLSC 166

  Fly   259 GPVEDFGLNGCDGGFQEAAFCFIDEVQKGV-------SQEGAYPY-------------------- 296
            .....|   ||:||...||:.:  .|:.|:       :..|..||                    
 Worm   167 CKSCGF---GCNGGDPLAAWRY--WVKDGIVTGSNYTANNGCKPYPFPPCEHHSKKTHFDPCPHD 226

  Fly   297 ------IDNKGTCKY-DGSKSGATLQGFAAIPPKDE-EQLKKVVATLGPVACSVNGLETLKNYAG 353
                  .:.|....| |.:.|.....|.:|...||: |.::|.:.|.||:..:....|...||.|
 Worm   227 LYPTPKCEKKCVSDYTDKTYSEDKFFGASAYGVKDDVEAIQKELMTHGPLEIAFEVYEDFLNYDG 291

  Fly   354 GIYNDDECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFI 411
            |:|.......| ..|::.::|:|.:.|..||.|.|||:..|||.|:||:.||.:.|.|
 Worm   292 GVYVHTGGKLG-GGHAVKLIGWGIDDGIPYWTVANSWNTDWGEDGFFRILRGVDECGI 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458
Peptidase_C1A 204..418 CDD:239068 74/252 (29%)
cpr-6NP_741818.1 Propeptide_C1 44..82 CDD:369701
Peptidase_C1A_CathepsinB 106..355 CDD:239111 74/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.