DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and F32H5.1

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_506310.1 Gene:F32H5.1 / 179815 WormBaseID:WBGene00009347 Length:356 Species:Caenorhabditis elegans


Alignment Length:284 Identity:68/284 - (23%)
Similarity:99/284 - (34%) Gaps:74/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LKRSPEAKARAAASLKLVNLPAKPIPDAFD----WREHGGVTPVKFQGTCGSCWAFATTGAIEGH 239
            :|.:.|...:......||:     ||.:||    |.....:..|:.|..|||.   |...|:|..
 Worm    73 IKSNDEVSEKTGNDNVLVD-----IPSSFDSRQKWPSCSQIGAVRDQSDCGSA---AHLVAVEIA 129

  Fly   240 TFRK------TGSLPNLSEQNLVDC--GPVEDFGLN-GCDGG--------FQEAAFC----FIDE 283
            :.|.      |.:.| ||.|:.:.|  |.:...|.. ||||.        :|....|    :.| 
 Worm   130 SDRTCIASNGTFNWP-LSAQDPLSCCVGLMSICGDGWGCDGSWPKDILKWWQTHGLCTGGNYND- 192

  Fly   284 VQKGVSQEGAYPYIDNKGTCKYDGSKSGATLQGFAAIPPKDEEQL-------------------- 328
                  |.|..||.......||....:.....|:..  |..||..                    
 Worm   193 ------QFGCKPYSIYPCDKKYANGTTSVPCPGYHT--PTCEEHCTSNITWPIAYKQDKHFGKAH 249

  Fly   329 ----KKV------VATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPNHSILVVGYGSEKGQDY 383
                ||:      :.|.|||..|....:...:|..|||.....:: |......::|:|.:.|..|
 Worm   250 YNVGKKMTDIQIEIMTNGPVIASFIIYDDFWDYKTGIYVHTAGDQ-EGGMDTKIIGWGVDNGVPY 313

  Fly   384 WIVKNSWDDTWGEKGYFRLPRGKN 407
            |:..:.|...:||.|:.|..||.|
 Worm   314 WLCVHQWGTDFGENGFVRFLRGVN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458
Peptidase_C1A 204..418 CDD:239068 63/259 (24%)
F32H5.1NP_506310.1 Peptidase_C1A_CathepsinB 93..348 CDD:239111 63/259 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.