DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and cpr-1

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_506002.2 Gene:cpr-1 / 179637 WormBaseID:WBGene00000781 Length:329 Species:Caenorhabditis elegans


Alignment Length:319 Identity:86/319 - (26%)
Similarity:127/319 - (39%) Gaps:85/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 AFADLTHSEFLSQLTG-------------------------LK-RSPEAKARAAAS--------- 192
            ||..:.|...:..|||                         :| :..:.|..||.|         
 Worm    15 AFVPINHQSAVETLTGQALVDYVNSAQSLFKTEHVEITEEEMKFKLMDGKYAAAHSDEIRATEQE 79

  Fly   193 LKLVNLPAKPIPDAFD----WREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKT--GSLPNLS 251
            :.|.::||     .||    |.|...:..::.|.||||||||.....|...|..:|  ...|.:|
 Worm    80 VVLASVPA-----TFDSRTQWSECKSIKLIRDQATCGSCWAFGAAEMISDRTCIETKGAQQPIIS 139

  Fly   252 EQNLV-----DCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAY------PY--------- 296
            ..:|:     .||       |||:||:...|..:.|  .|||...|.|      ||         
 Worm   140 PDDLLSCCGSSCG-------NGCEGGYPIQALRWWD--SKGVVTGGDYHGAGCKPYPIAPCTSGN 195

  Fly   297 -IDNKG-----TCKYDGSKSGATLQGF---AAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYA 352
             .::|.     :|:...|.:.|..:.|   |...||:...::..:...|||..:.:..|....|.
 Worm   196 CPESKTPSCSMSCQSGYSTAYAKDKHFGVSAYAVPKNAASIQAEIYANGPVEAAFSVYEDFYKYK 260

  Fly   353 GGIYNDDECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFI 411
            .|:|. ....|....|:|.::|:|:|.|..||:|.|||...|||.|:|::.||.:.|.|
 Worm   261 SGVYK-HTAGKYLGGHAIKIIGWGTESGSPYWLVANSWGVNWGESGFFKIYRGDDQCGI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 3/8 (38%)
Peptidase_C1A 204..418 CDD:239068 72/243 (30%)
cpr-1NP_506002.2 Peptidase_C1A_CathepsinB 86..325 CDD:239111 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.