DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and cpr-5

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_503383.1 Gene:cpr-5 / 178612 WormBaseID:WBGene00000785 Length:344 Species:Caenorhabditis elegans


Alignment Length:259 Identity:76/259 - (29%)
Similarity:113/259 - (43%) Gaps:61/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 IPDAFD----WREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPN--LSEQNLVDCGPV 261
            |||.||    |.....:..::.|..||||||||...||...|...:....|  ||.::|:.|.. 
 Worm    82 IPDHFDARDQWPNCMSINNIRDQSDCGSCWAFAAAEAISDRTCIASNGAVNTLLSSEDLLSCCT- 145

  Fly   262 EDFGL----NGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCK-YDGSKSGATLQG--FAA 319
               |:    |||:||:...|:.:  .|:.|:...|:|   :.:..|| |..:..|.|:.|  :.|
 Worm   146 ---GMFSCGNGCEGGYPIQAWKW--WVKHGLVTGGSY---ETQFGCKPYSIAPCGETVNGVKWPA 202

  Fly   320 IPPKDE------------------------------------EQLKKVVATLGPVACSVNGLETL 348
            .|...|                                    ||::..:.|.||:..:....|..
 Worm   203 CPEDTEPTPKCVDSCTSKNNYATPYLQDKHFGSTAYAVGKKVEQIQTEILTNGPIEVAFTVYEDF 267

  Fly   349 KNYAGGIY-NDDECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFI 411
            ..|..|:| :....:.|  .|::.::|:|.:.|..||:|.|||:..||||||||:.||.|.|.|
 Worm   268 YQYTTGVYVHTAGASLG--GHAVKILGWGVDNGTPYWLVANSWNVAWGEKGYFRIIRGLNECGI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458
Peptidase_C1A 204..418 CDD:239068 75/258 (29%)
cpr-5NP_503383.1 Propeptide_C1 30..63 CDD:285358
Peptidase_C1A_CathepsinB 83..336 CDD:239111 75/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.