Sequence 1: | NP_725686.1 | Gene: | CG4847 / 36973 | FlyBaseID: | FBgn0034229 | Length: | 420 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503383.1 | Gene: | cpr-5 / 178612 | WormBaseID: | WBGene00000785 | Length: | 344 | Species: | Caenorhabditis elegans |
Alignment Length: | 259 | Identity: | 76/259 - (29%) |
---|---|---|---|
Similarity: | 113/259 - (43%) | Gaps: | 61/259 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 203 IPDAFD----WREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPN--LSEQNLVDCGPV 261
Fly 262 EDFGL----NGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCK-YDGSKSGATLQG--FAA 319
Fly 320 IPPKDE------------------------------------EQLKKVVATLGPVACSVNGLETL 348
Fly 349 KNYAGGIY-NDDECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFI 411 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4847 | NP_725686.1 | Inhibitor_I29 | 112..172 | CDD:285458 | |
Peptidase_C1A | 204..418 | CDD:239068 | 75/258 (29%) | ||
cpr-5 | NP_503383.1 | Propeptide_C1 | 30..63 | CDD:285358 | |
Peptidase_C1A_CathepsinB | 83..336 | CDD:239111 | 75/258 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4870 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53545 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |