DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and cpz-1

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_491023.2 Gene:cpz-1 / 171829 WormBaseID:WBGene00000788 Length:306 Species:Caenorhabditis elegans


Alignment Length:264 Identity:73/264 - (27%)
Similarity:112/264 - (42%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 AKPIPDAFDWREHGGVTPVKFQGT------CGSCWAFATTGAIEGH-TFRKTGSLPN--LSEQNL 255
            ::.:|..:|||:..|:........      |||||||..|.|:... ..::..:.|.  ||.|.:
 Worm    62 SEDLPKTWDWRDANGINYASADRNQHIPQYCGSCWAFGATSALADRINIKRKNAWPQAYLSVQEV 126

  Fly   256 VDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCK---------------- 304
            :||.......:.|..||..:.|.      :.|:..|....|....|.|.                
 Worm   127 IDCSGAGTCVMGGEPGGVYKYAH------EHGIPHETCNNYQARDGKCDPYNRCGSCWPGECFSI 185

  Fly   305 -----YDGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYND--DECN 362
                 |..|:.| |:.|:        |::|..:...||:||.:...:..:.||||||.:  ||  
 Worm   186 KNYTLYKVSEYG-TVHGY--------EKMKAEIYHKGPIACGIAATKAFETYAGGIYKEVTDE-- 239

  Fly   363 KGEPNHSILVVGYG--SEKGQDYWIVKNSWDDTWGEKGYFRL------PRGKNYCF-IAEECSY- 417
              :.:|.|.|.|:|  .|.|.:|||.:|||.:.|||.|:|::      ..|..|.. |.|:|.: 
 Worm   240 --DIDHIISVHGWGVDHESGVEYWIGRNSWGEPWGEHGWFKIVTSQYKNAGSKYNLKIEEDCVWA 302

  Fly   418 -PVV 420
             |:|
 Worm   303 DPIV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458
Peptidase_C1A 204..418 CDD:239068 71/256 (28%)
cpz-1NP_491023.2 Peptidase_C1A_CathepsinX 65..305 CDD:239149 71/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.