DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and CTSZ

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001327.2 Gene:CTSZ / 1522 HGNCID:2547 Length:303 Species:Homo sapiens


Alignment Length:318 Identity:90/318 - (28%)
Similarity:133/318 - (41%) Gaps:77/318 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 AAFAQGVHTFKQAVNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPAKPIPDAFDWREH 212
            |..|||...|::....:..|..    ..|..|.||...:.....|      || .:|.::|||..
Human    18 AGAAQGGLYFRRGQTCYRPLRG----DGLAPLGRSTYPRPHEYLS------PA-DLPKSWDWRNV 71

  Fly   213 GGVTPVKFQGT------CGSCWAFATTGAIEGH-TFRKTGSLPN--LSEQNLVDCGPVEDFGLNG 268
            .||........      ||||||.|:|.|:... ..::.|:.|:  ||.||::|||     ....
Human    72 DGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCG-----NAGS 131

  Fly   269 CDGGFQEAAFCFIDEVQKGVSQEGAYPY---------IDNKGTC----------KYD-------G 307
            |:||...:.:.:..  |.|:..|....|         .:..|||          .|.       |
Human   132 CEGGNDLSVWDYAH--QHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYG 194

  Fly   308 SKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPNHSILV 372
            |.||.            |:.:.::.|. ||::|.:...|.|.||.||||.:.: :....||.:.|
Human   195 SLSGR------------EKMMAEIYAN-GPISCGIMATERLANYTGGIYAEYQ-DTTYINHVVSV 245

  Fly   373 VGYGSEKGQDYWIVKNSWDDTWGEKGYFRL-------PRGKNY-CFIAEECSY--PVV 420
            .|:|...|.:||||:|||.:.|||:|:.|:       .:|..| ..|.|.|::  |:|
Human   246 AGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 6/23 (26%)
Peptidase_C1A 204..418 CDD:239068 75/258 (29%)
CTSZNP_001327.2 Peptidase_C1A_CathepsinX 62..302 CDD:239149 75/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.