DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and CTSO

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001325.1 Gene:CTSO / 1519 HGNCID:2542 Length:321 Species:Homo sapiens


Alignment Length:323 Identity:102/323 - (31%)
Similarity:163/323 - (50%) Gaps:13/323 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KAVPKVPLLSNV--QDFGDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQA 160
            :|:|.:|.|..:  :..||..|::..|......|.....||..:.|.....|:.|.....|....
Human     4 RALPWLPWLLWLLCRGGGDADSRAPFTPTWPRSREREAAAFRESLNRHRYLNSLFPSENSTAFYG 68

  Fly   161 VNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGTCG 225
            :|.|:.|...||  :...|:..|....|.:|.:.: ::|...:|..||||:...||.|:.|..||
Human    69 INQFSYLFPEEF--KAIYLRSKPSKFPRYSAEVHM-SIPNVSLPLRFDWRDKQVVTQVRNQQMCG 130

  Fly   226 SCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQ 290
            .||||:..||:|.....|...|.:||.|.::||    .:...||:||....|..:::::|..:.:
Human   131 GCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDC----SYNNYGCNGGSTLNALNWLNKMQVKLVK 191

  Fly   291 EGAYPYIDNKGTCKY-DGSKSGATLQGFAAIPPKD-EEQLKKVVATLGPVACSVNGLETLKNYAG 353
            :..||:....|.|.| .||.||.:::|::|....| |:::.|.:.|.||:...|:.: :.::|.|
Human   192 DSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAV-SWQDYLG 255

  Fly   354 GIYNDDECNKGEPNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFIAEECS 416
            ||. ...|:.||.||::|:.|:.......||||:|||..:||..||..:..|.|.|.||:..|
Human   256 GII-QHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 14/59 (24%)
Peptidase_C1A 204..418 CDD:239068 77/215 (36%)
CTSONP_001325.1 Peptidase_C1A 109..319 CDD:239068 77/215 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5966
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.