DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and CTSV

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001188504.1 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens


Alignment Length:332 Identity:129/332 - (38%)
Similarity:179/332 - (53%) Gaps:18/332 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IAKAVPKVPLLSNVQDFGDFLSQSGKTYLSAADRALHEGAFASTKNLVEAGNAAFAQGVHTFKQA 160
            ||.||||..  .|:.........:.:....|.:.......:.....::|..|..::||.|.|..|
Human    14 IASAVPKFD--QNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMA 76

  Fly   161 VNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPA-KPIPDAFDWREHGGVTPVKFQGTC 224
            :|||.|:|:.|| .|:.|..|:.:.:..     |:...|. ..:|.:.|||:.|.|||||.|..|
Human    77 MNAFGDMTNEEF-RQMMGCFRNQKFRKG-----KVFREPLFLDLPKSVDWRKKGYVTPVKNQKQC 135

  Fly   225 GSCWAFATTGAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVS 289
            ||||||:.|||:||..|||||.|.:|||||||||...:  |..||:|||...||.::.| ..|:.
Human   136 GSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQ--GNQGCNGGFMARAFQYVKE-NGGLD 197

  Fly   290 QEGAYPYIDNKGTCKYDGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVN-GLETLKNYAG 353
            .|.:|||:.....|||....|.|...||..:.|..|:.|.|.|||:||::.::: |..:.:.|..
Human   198 SEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKS 262

  Fly   354 GIYNDDECNKGEPNHSILVVGYGSE----KGQDYWIVKNSWDDTWGEKGYFRLPRGK-NYCFIAE 413
            |||.:.:|:....:|.:||||||.|    ....||:|||||...||..||.::.:.| |:|.||.
Human   263 GIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIAT 327

  Fly   414 ECSYPVV 420
            ..|||.|
Human   328 AASYPNV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 13/59 (22%)
Peptidase_C1A 204..418 CDD:239068 99/219 (45%)
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 13/57 (23%)
Peptidase_C1 114..332 CDD:306594 99/220 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.