DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and CTSB

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001371643.1 Gene:CTSB / 1508 HGNCID:2527 Length:339 Species:Homo sapiens


Alignment Length:327 Identity:88/327 - (26%)
Similarity:134/327 - (40%) Gaps:87/327 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NLVEAGNAAFAQGVHTFKQAVNAFADLTHSEFLSQLTGL---KRSPEAKARAAASLKLVNLPAKP 202
            |.|...|..:..| |.|..     .|::   :|.:|.|.   ...|..:......|||       
Human    32 NYVNKRNTTWQAG-HNFYN-----VDMS---YLKRLCGTFLGGPKPPQRVMFTEDLKL------- 80

  Fly   203 IPDAFDWREHGGVTP----VKFQGTCGSCWAFATTGAIEG-------HTFRKTGSLPNLSEQNLV 256
             |.:||.||.....|    ::.||:|||||||   ||:|.       ||.... |:...:|..|.
Human    81 -PASFDAREQWPQCPTIKEIRDQGSCGSCWAF---GAVEAISDRICIHTNAHV-SVEVSAEDLLT 140

  Fly   257 DCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAY-------PYIDNKGTCKY--DGSKSGA 312
            .||.:..   :||:||:...|:.|  ..:||:...|.|       ||  :...|::  :||:...
Human   141 CCGSMCG---DGCNGGYPAEAWNF--WTRKGLVSGGLYESHVGCRPY--SIPPCEHHVNGSRPPC 198

  Fly   313 TLQGFAAIPPK----------------------------DEEQLKKVVATLGPVACSVNGLETLK 349
            |.:|..   ||                            .|:.:...:...|||..:.:......
Human   199 TGEGDT---PKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFL 260

  Fly   350 NYAGGIYNDDECNKGE--PNHSILVVGYGSEKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFIA 412
            .|..|:|   :...||  ..|:|.::|:|.|.|..||:|.|||:..||:.|:|::.||:::|.|.
Human   261 LYKSGVY---QHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIE 322

  Fly   413 EE 414
            .|
Human   323 SE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 7/30 (23%)
Peptidase_C1A 204..418 CDD:239068 74/261 (28%)
CTSBNP_001371643.1 Propeptide_C1 26..65 CDD:400445 10/41 (24%)
Peptidase_C1A_CathepsinB 81..328 CDD:239111 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.