DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and Ctsw

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_034115.2 Gene:Ctsw / 13041 MGIID:1338045 Length:371 Species:Mus musculus


Alignment Length:336 Identity:105/336 - (31%)
Similarity:155/336 - (46%) Gaps:57/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FLSQSGKTYLSAADRALHEGAFASTKNLVEA--------GNAAFAQGVHTFKQAVNAFADLTHSE 171
            |..:..::|.:.|:.......||  .||.:|        |.|.|.:         ..|:|||..|
Mouse    43 FQIRFNRSYWNPAEYTRRLSIFA--HNLAQAQRLQQEDLGTAEFGE---------TPFSDLTEEE 96

  Fly   172 FLSQLTGLKRSPEAKARAAASLKLV--NLPAKPIPDAFDWREHGG-VTPVKFQGTCGSCWAFATT 233
            | .||.|.:||||   |.....|.|  |...:.:|...|||:... ::.||.||:|..|||.|..
Mouse    97 F-GQLYGQERSPE---RTPNMTKKVESNTWGESVPRTCDWRKAKNIISSVKNQGSCKCCWAMAAA 157

  Fly   234 GAIEGHTFRKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYID 298
            ..|:.....|.....::|.|.|:||   |..| |||:|||...|:..:.. ..|::.|..||:..
Mouse   158 DNIQALWRIKHQQFVDVSVQELLDC---ERCG-NGCNGGFVWDAYLTVLN-NSGLASEKDYPFQG 217

  Fly   299 NK--GTCKYDGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIY--NDD 359
            ::  ..|.....|..|.:|.|..: ..:|:.:...:|..||:..::| ::.|::|..|:.  ...
Mouse   218 DRKPHRCLAKKYKKVAWIQDFTML-SNNEQAIAHYLAVHGPITVTIN-MKLLQHYQKGVIKATPS 280

  Fly   360 ECNKGEPNHSILVVGYGSEK-----------------GQDYWIVKNSWDDTWGEKGYFRLPRGKN 407
            .|:..:.:||:|:||:|.||                 ...|||:||||...|||||||||.||.|
Mouse   281 SCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNN 345

  Fly   408 YCFIAEECSYP 418
            .|.:.:   ||
Mouse   346 TCGVTK---YP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 15/64 (23%)
Peptidase_C1A 204..418 CDD:239068 75/235 (32%)
CtswNP_034115.2 Inhibitor_I29 40..96 CDD:214853 15/63 (24%)
Peptidase_C1 126..356 CDD:278538 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.