DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and CTSC

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001805.4 Gene:CTSC / 1075 HGNCID:2528 Length:463 Species:Homo sapiens


Alignment Length:319 Identity:96/319 - (30%)
Similarity:138/319 - (43%) Gaps:66/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 ASTKNLVEAGNAAFAQGVHTFKQAVNA------------FADLTHSEFLSQLTG----LKRSPEA 185
            |..||..|..:....:..|.|.:|:||            :..||..:.:.:..|    :.|...|
Human   154 AHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPA 218

  Fly   186 KARAAASLKLVNLPAKPIPDAFDWRE-HG--GVTPVKFQGTCGSCWAFATTGAIEG--HTFRKTG 245
            ...|....|:::||.     ::|||. ||  .|:||:.|.:||||::||:.|.:|.  .......
Human   219 PLTAEIQQKILHLPT-----SWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNS 278

  Fly   246 SLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQK--GVSQEGAYPYIDNKGTCK---- 304
            ..|.||.|.:|.|...    ..||:|||   .:....:..:  |:.:|..:||......||    
Human   279 QTPILSPQEVVSCSQY----AQGCEGGF---PYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKED 336

  Fly   305 ----------YDGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYND- 358
                      |.|...|..          :|..:|..:...||:|.:....:...:|..|||:. 
Human   337 CFRYYSSEYHYVGGFYGGC----------NEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT 391

  Fly   359 ---DECNKGE-PNHSILVVGYG--SEKGQDYWIVKNSWDDTWGEKGYFRLPRGKNYCFI 411
               |..|..| .||::|:||||  |..|.|||||||||...|||.||||:.||.:.|.|
Human   392 GLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAI 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 11/46 (24%)
Peptidase_C1A 204..418 CDD:239068 78/236 (33%)
CTSCNP_001805.4 CathepsinC_exc 26..138 CDD:312344
Peptidase_C1A_CathepsinC 231..460 CDD:239112 80/242 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.