DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and LOC100536033

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_003199631.1 Gene:LOC100536033 / 100536033 -ID:- Length:336 Species:Danio rerio


Alignment Length:316 Identity:127/316 - (40%)
Similarity:180/316 - (56%) Gaps:24/316 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SQSGKTY---LSAADRALHEGAFASTKNL--VEAGNAAFAQGVHTFKQAVNAFADLTHSEFLSQL 176
            ||.||:|   :....|.:.|      :||  :|..|..::.|.||||..:|.|.|:|:.||...:
Zfish    33 SQHGKSYHEDVEVGRRMIWE------ENLRKIEQHNFEYSYGNHTFKMGMNQFGDMTNEEFRHAM 91

  Fly   177 TGLKRSPEAKARAAASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTF 241
            .|.|..|...::....::.....|   |...|||:.|.|||||.|..|||||:|::|||:||..|
Zfish    92 NGYKHDPNQTSQGPLFMEPSFFAA---PQQVDWRQRGYVTPVKDQKQCGSCWSFSSTGALEGQLF 153

  Fly   242 RKTGSLPNLSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKG-TCKY 305
            ||||.|.::||||||||.  ...|..||:||..:.||.::.| .||:..|.:|||:.... .|:|
Zfish   154 RKTGKLISMSEQNLVDCS--RPHGNQGCNGGLMDQAFQYVKE-NKGLDSEQSYPYLARDDLPCRY 215

  Fly   306 DGSKSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGL-ETLKNYAGGIYNDDECNKGEPNHS 369
            |...:.|.:.||..||..:|..|...||.:|||:.:::.. ::|:.|..|||.:..|:....:|:
Zfish   216 DPRFNVAKITGFVDIPKGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHA 280

  Fly   370 ILVVGYGSE----KGQDYWIVKNSWDDTWGEKGYFRLPRGK-NYCFIAEECSYPVV 420
            :||||||.:    .|..||||||||.|.||:|||..:.:.| |:|.||...|||::
Zfish   281 VLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGIATMASYPLM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 20/59 (34%)
Peptidase_C1A 204..418 CDD:239068 99/220 (45%)
LOC100536033XP_003199631.1 Inhibitor_I29 28..86 CDD:214853 20/58 (34%)
Peptidase_C1 115..335 CDD:306594 101/225 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.