DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and LOC100333521

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002661007.2 Gene:LOC100333521 / 100333521 -ID:- Length:301 Species:Danio rerio


Alignment Length:317 Identity:88/317 - (27%)
Similarity:139/317 - (43%) Gaps:65/317 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AQGVHTFKQAVNAFADLTHSEFLSQLTGLKRS---------P---EAKARAAASLKLVNLPAKPI 203
            |..|..|...:|.|   .|:|..:::..|..|         |   :..||....|.:.:|||   
Zfish     2 APAVLWFSFLLNVF---VHTEGFTEVQPLPDSCYKPMKDHRPSFIKTYARPHEYLNVSDLPA--- 60

  Fly   204 PDAFDWREHGGVTPVKFQGT------CGSCWAFATTGAIEGH-TFRKTGSLPN--LSEQNLVDCG 259
              ::|||...|...|.....      ||||||..:|.|:... ..::.|:.|:  ||.||::|||
Zfish    61 --SWDWRNIDGKNYVSITRNQHIPQYCGSCWAMGSTSALADRINIKRKGAWPSAYLSVQNVIDCG 123

  Fly   260 PVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPY---------IDNKGTCKYDGSKSGATLQ 315
            ..     ..|.||.....:.:.:|  .|:..|....|         .:..|||.:.||.|  .::
Zfish   124 KA-----GSCFGGDHLGVYAYANE--HGIPDETCNNYQARNQKCDPFNQCGTCSFFGSCS--IIK 179

  Fly   316 GFAAIPPKD------EEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPNHSILVVG 374
            .:......|      .:::|..:...||::|::...:.|:.|.||::.:... ...|||.|.|.|
Zfish   180 NYTVWKVGDYGDISGRDRMKAEIFKNGPISCAIMATKGLEAYDGGVFAEFHI-LSMPNHIISVAG 243

  Fly   375 YG-SEKGQDYWIVKNSWDDTWGEKGYFRL-----PRGKNYCF---IAEECSY--PVV 420
            :| :|.|.:||||:|||.:.|||.|:.|:     ..||...:   |..:|:|  |:|
Zfish   244 WGVTEDGTEYWIVRNSWGEFWGESGWARIVTSAYKGGKGNWYNVAIENDCAYGDPIV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 6/20 (30%)
Peptidase_C1A 204..418 CDD:239068 70/248 (28%)
LOC100333521XP_002661007.2 Peptidase_C1A_CathepsinX 58..299 CDD:239149 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.