DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4847 and ctsz

DIOPT Version :9

Sequence 1:NP_725686.1 Gene:CG4847 / 36973 FlyBaseID:FBgn0034229 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001106427.1 Gene:ctsz / 100127597 XenbaseID:XB-GENE-959211 Length:296 Species:Xenopus tropicalis


Alignment Length:318 Identity:85/318 - (26%)
Similarity:133/318 - (41%) Gaps:80/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 AGNAAFAQGVHTFKQAVNAFADLTHSEFLSQLTGLKRSPEAKARAAASLKLVNLPAKPIPDAFDW 209
            :|...|.||.|.::..            |.:..|::..|....         .||...:|..:||
 Frog    16 SGGLYFQQGQHCYRPP------------LKRHPGIRTYPRPHE---------YLPVSELPKVWDW 59

  Fly   210 REHGGVTPVK------FQGTCGSCWAFATTGAIEGH-TFRKTGSLPN--LSEQNLVDCGPVEDFG 265
            |...|...|.      ....||||||..:|.|:... ..::.|..|:  ||.|:::||.     .
 Frog    60 RNLNGTNYVSTTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGVWPSAYLSVQHVIDCA-----N 119

  Fly   266 LNGCDGGFQEAAFCFIDEVQKGVSQE--GAYPYIDNK-------GTCKYDGS---KSGATL---Q 315
            ...|:||.....:.:.:  ..|:..|  ..|...|.|       |||...|.   .|..||   .
 Frog   120 AGSCEGGDHGGVWEYAN--SHGIPDETCNNYQARDQKCDKFNQCGTCVTFGKCFYLSNYTLWKVG 182

  Fly   316 GFAAIPPKDEEQLKKVVATL---GPVACSVNGLETLKNYAGGIYNDDECNKGEP----NHSILVV 373
            .|.::..::     |::|.:   ||::|.:...|.|..|.||:|.:     .:|    ||.:.|.
 Frog   183 DFGSVSGRE-----KMMAEIYKNGPISCGIMATEKLDAYTGGLYAE-----YQPSAMINHIVSVA 237

  Fly   374 GYG-SEKGQDYWIVKNSWDDTWGEKGYFRL-------PRGKNY-CFIAEECSY--PVV 420
            |:| .|.|.:||||:|||.:.|||:|:.|:       .:|.:| ..|.|:|:|  |::
 Frog   238 GWGLDESGAEYWIVRNSWGEPWGERGWLRIVTSAYKGGKGADYNLAIEEDCAYGDPIL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4847NP_725686.1 Inhibitor_I29 112..172 CDD:285458 5/26 (19%)
Peptidase_C1A 204..418 CDD:239068 74/255 (29%)
ctszNP_001106427.1 Peptidase_C1A_CathepsinX 53..294 CDD:239149 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.