DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veil and Nt5e

DIOPT Version :10

Sequence 1:NP_611217.1 Gene:veil / 36968 FlyBaseID:FBgn0034225 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_035981.1 Gene:Nt5e / 23959 MGIID:99782 Length:576 Species:Mus musculus


Alignment Length:53 Identity:16/53 - (30%)
Similarity:20/53 - (37%) Gaps:16/53 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VNIQGTRK-EWDLTPEREDCRRNKRWNSEEIIEISSTGKGGPIANGTNEDEDD 108
            :.||..|. ||...|:           :..|.||||    ||.....:||..|
Mouse    36 LEIQRNRDIEWKFGPQ-----------NILIAEISS----GPYKITLHEDALD 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veilNP_611217.1 MPP_CD73_N 37..330 CDD:277354 16/53 (30%)
5_nucleotid_C 358..534 CDD:427027
Nt5eNP_035981.1 MPP_CD73_N 31..312 CDD:277354 16/53 (30%)
5_nucleotid_C 341..515 CDD:427027
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.