DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and AT3G08620

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_187474.2 Gene:AT3G08620 / 820009 AraportID:AT3G08620 Length:283 Species:Arabidopsis thaliana


Alignment Length:244 Identity:69/244 - (28%)
Similarity:115/244 - (47%) Gaps:64/244 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NEYIRDCMAERNRMD---RKFPIAEKLLEGEIEKVQTTGRIPSREQKYADIYREK---------- 117
            ::||...:||..::.   :..||..:||..||.::  ||.:|:  |.:.|..|.:          
plant    29 SQYISQLLAEHQKLGPFMQVLPICSRLLNQEIFRI--TGMMPN--QGFTDFDRLRHRSPSPMASP 89

  Fly   118 ------------------PLRIS---------------------QRVL---VPIREHPKFNFVGK 140
                              |.||.                     :|:|   :|:..:|.|||||:
plant    90 NLMSNVSGGGLGGWNGLPPERIGGPHGMAMEWQGAPASPSSYPVKRILRLDLPVDTYPNFNFVGR 154

  Fly   141 LLGPKGNSLRRLQEETLCKMTVLGRNSMRDRVKEEELRSSKDPKYAHLNSDLHVEISTIAPPAEA 205
            ||||:||||:|::..|.|::.:.|:.|::|..|||:|:..  |.|.|||..||:.|....|....
plant   155 LLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLKGK--PGYEHLNEQLHILIEADLPIDIV 217

  Fly   206 YARIAYAMAELRKYLIP--DSNDIIRQEQLREL-MDSTSLNDNDNAKSG 251
            ..::..|...:.:.:.|  :|.|.|:::||||| :.:::|.:|....||
plant   218 DIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLRENSPGPSG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 16/51 (31%)
SF1_like-KH 122..237 CDD:239088 46/141 (33%)
AT3G08620NP_187474.2 STAR_dimer 28..74 CDD:406848 14/48 (29%)
KH-I 134..234 CDD:412160 37/101 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.