DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and AT2G38610

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_181395.1 Gene:AT2G38610 / 818443 AraportID:AT2G38610 Length:286 Species:Arabidopsis thaliana


Alignment Length:275 Identity:73/275 - (26%)
Similarity:124/275 - (45%) Gaps:80/275 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ANEYIRDCMAERNRMD---RKFPIAEKLLEGEIEKVQTTGRIPSREQKYADIYR-----EKPL-- 119
            :::|:.:.:||..::.   :..||..:||..|:.:|  :|.:.:  |.:.|..|     ..|:  
plant    29 SSQYLTELLAEHQKLTPFMQVLPICSRLLNQEMFRV--SGMMSN--QGFGDFDRLRHRSPSPMAS 89

  Fly   120 ---------------------RIS---------------------QRVL---VPIREHPKFNFVG 139
                                 |:|                     :|:|   :|:..:|.|||||
plant    90 SNLMSNVSNTGLGGWNGLSQERLSGTPGMTMDWQGAPGSPSSYTVKRILRLEIPVDNYPNFNFVG 154

  Fly   140 KLLGPKGNSLRRLQEETLCKMTVLGRNSMRDRVKEEELRSSKDPKYAHLNSDLHVEISTIAPPAE 204
            :||||:||||:|::..|.|::.:.|:.|::|..||::||..  |.|.|||..||:.|....|.:.
plant   155 RLLGPRGNSLKRVEATTGCRVFIRGKGSIKDPEKEDKLRGR--PGYEHLNEQLHILIEADLPASI 217

  Fly   205 AYARIAYAMAELRKYLIP--DSNDIIRQEQLRE--LMDSTSLNDNDNAKSGYKKTSHMQGGNNVL 265
            ...|:..|...:.:.|.|  :|.|.|:::||||  |::|.:|.:.....|               
plant   218 VEIRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNNLREESPGPS--------------- 267

  Fly   266 GGGSINPIGGVKNTP 280
            ||||::|.......|
plant   268 GGGSVSPFNSSGKRP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 13/56 (23%)
SF1_like-KH 122..237 CDD:239088 48/142 (34%)
AT2G38610NP_181395.1 STAR_dimer 29..75 CDD:406848 11/49 (22%)
KH-I 135..235 CDD:412160 39/101 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.