DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and Qk

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_038942853.1 Gene:Qk / 499022 RGDID:1584886 Length:341 Species:Rattus norvegicus


Alignment Length:348 Identity:90/348 - (25%)
Similarity:153/348 - (43%) Gaps:83/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GNVQINEKAN---EYIRDCMAERNRMDRK------FPIAEKLLEGEIEKVQTTGRIPSREQKYAD 112
            |.::..||..   :|:...|.::..|...      |...|:||:.||.:|        |:..|.|
  Rat     3 GEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRV--------RKDMYND 59

  Fly   113 IYR--------EKP------LRISQRVLVPIREHPKFNFVGKLLGPKGNSLRRLQEETLCKMTVL 163
            ...        |.|      :::.:::.||::|:|.|||||::|||:|.:.::|:.||.||:.|.
  Rat    60 TLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVR 124

  Fly   164 GRNSMRDRVKEEELRSSKDPKYAHLNSDLHVEISTIAPPAEAYARIAYAMAELRKYLIP--DSND 226
            |:.||||:.|||:.|..  |.:.|||.||||.|:.......|..::..|:.|::|.|:|  :..|
  Rat   125 GKGSMRDKKKEEQNRGK--PNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGED 187

  Fly   227 IIRQEQLRELMDSTSLNDNDNAKS---GYKKTSHMQGGNNVLGGGSINPIGGVKNTPHHSYRSSQ 288
            .:::.||.||........:.|.||   .:...:..|....::.|.:  |:     .|..:.|:..
  Rat   188 SLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPA--PV-----LPPAALRTPT 245

  Fly   289 PSSFSKNVLAPKQKVMSILEKARTAM---------DETYGRGYDDGLGYDPHQSYDSYSYGTHGH 344
            |:.         ..:|.::.:.:||:         ......|.:.||.|.|::    |.|..   
  Rat   246 PAG---------PTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYE----YPYTL--- 294

  Fly   345 GPHGP----------PANILGGV 357
               .|          |:.:||.|
  Rat   295 ---APATSILEYPIEPSGVLGAV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 13/62 (21%)
SF1_like-KH 122..237 CDD:239088 47/116 (41%)
QkXP_038942853.1 STAR_dimer 10..66 CDD:406848 14/63 (22%)
KH-I_Hqk 81..183 CDD:411893 43/103 (42%)
PHA03247 <211..314 CDD:223021 21/128 (16%)
Quaking_NLS 312..341 CDD:406855 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.