Sequence 1: | NP_001261050.1 | Gene: | qkr54B / 36966 | FlyBaseID: | FBgn0022987 | Length: | 617 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001040836.2 | Gene: | B0280.17 / 4363051 | WormBaseID: | WBGene00044674 | Length: | 260 | Species: | Caenorhabditis elegans |
Alignment Length: | 246 | Identity: | 51/246 - (20%) |
---|---|---|---|
Similarity: | 96/246 - (39%) | Gaps: | 73/246 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 NEKANEYIRDCMAERNRMDR--------KFPIAEKLLEGEIEKVQTT-----------------G 101
Fly 102 RIPSREQKYAD------IYREKPLRIS-------QRVLVPI-----------------REHPKF- 135
Fly 136 ---------------NFVGKLLGPKGNSLRRLQEETLCKMTVLGRNSMRDRVKEEELRSSKDPKY 185
Fly 186 AHLNSDLHVEISTIAPPAEAYARIAYAMAELRKYLIPDSNDIIRQEQLREL 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
qkr54B | NP_001261050.1 | Qua1 | 68..117 | CDD:292891 | 15/79 (19%) |
SF1_like-KH | 122..237 | CDD:239088 | 33/155 (21%) | ||
B0280.17 | NP_001040836.2 | KH-I | 141..260 | CDD:381803 | 29/114 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5176 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |