DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and how

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster


Alignment Length:216 Identity:71/216 - (32%)
Similarity:118/216 - (54%) Gaps:40/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QINEKANEYIRDCMAERNRMDRK--------FPIAEKLLEGEIEKVQTTGRIPSREQKYADIY-- 114
            |..:::.:.|.|.:|:..: |||        |...|:||:.||.:|:            |.::  
  Fly    66 QQQQQSTQSIADYLAQLLK-DRKQLAAFPNVFTHVERLLDEEIARVR------------ASLFQI 117

  Fly   115 ---REKPLRI----------SQRVLVPIREHPKFNFVGKLLGPKGNSLRRLQEETLCKMTVLGRN 166
               :::||.:          :::|.||:||||.|||||::|||:|.:.::|::||.||:.|.|:.
  Fly   118 NGVKKEPLTLPEPEGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKG 182

  Fly   167 SMRDRVKEEELRSSKDPKYAHLNSDLHVEISTIAPPAEAYARIAYAMAELRKYLIP--DSNDIIR 229
            ||||:.||:..|..  |.:.||:.||||.|:.......|..::|.|:||::|.|:|  :..|.::
  Fly   183 SMRDKKKEDANRGK--PNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELK 245

  Fly   230 QEQLRELMDSTSLNDNDNAKS 250
            :.||.||........:..|||
  Fly   246 KRQLMELAIINGTYRDTTAKS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 14/61 (23%)
SF1_like-KH 122..237 CDD:239088 50/116 (43%)
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 14/60 (23%)
SF1_like-KH 139..260 CDD:239088 51/122 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460720
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D66954at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.