DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and qkr58E-3

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster


Alignment Length:305 Identity:126/305 - (41%)
Similarity:185/305 - (60%) Gaps:46/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HDHGHHGGDPGGNVQINEKANEYIRDCMAERNRMDRKFPIAEKLLEGEIEKVQTTGRIPSREQKY 110
            |||         ..::||.|.:::.|...||.|:...||:...|::..:::|..|||||.:| .|
  Fly    15 HDH---------QPRLNEVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKE-FY 69

  Fly   111 ADIYREKPLRISQRVLVPIREHPKFNFVGKLLGPKGNSLRRLQEETLCKMTVLGRNSMRDRVKEE 175
            ||:|::||::|:|:|.||::::|||||.||:|||||||||||||||.||:.:.||:|:|||.|||
  Fly    70 ADVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEE 134

  Fly   176 ELRSSKDPKYAHLNSDLHVEISTIAPPAEAYARIAYAMAELRKYLIPDSNDIIRQEQLRELMDST 240
            :|||:.||:||||..||.:|:||:|.|||.|||||||:||:|||||||.||.:..|||||||:. 
  Fly   135 QLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRELMEM- 198

  Fly   241 SLNDNDNAKS-------GYKKTSHMQ-GGN--------NVLGGGSINP--IGGVKNTPH------ 281
               |.::||:       .|:.....: |||        |::...:.||  :..|:...:      
  Fly   199 ---DPESAKNIHGPNLEAYRSVFDKKFGGNSNGAPKYINLIKRAAENPPEVDDVEEVAYEYEHRM 260

  Fly   282 --------HSYRSSQPSSFSKNVLAPKQKVMSILEKARTAMDETY 318
                    :.|...:||....|..|.|:...:.:::.|....::|
  Fly   261 PPKRPPTGYEYSKPRPSIIPTNAAAYKRPYPTDMKRMREPPIKSY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 18/48 (38%)
SF1_like-KH 122..237 CDD:239088 78/114 (68%)
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 80/122 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468747
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3911
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.