DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and Y69A2AR.32

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_741340.2 Gene:Y69A2AR.32 / 177042 WormBaseID:WBGene00022101 Length:384 Species:Caenorhabditis elegans


Alignment Length:186 Identity:51/186 - (27%)
Similarity:93/186 - (50%) Gaps:29/186 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PIAEKLLEGEIEKVQTTGRIPSREQKYADIYREKPLRISQRVLVPIREHPKFNFVGKLLGPKGNS 148
            |..::..|.|:.      |.......|.|..|:..:.:|:.::||:.::||:||||::|||:|.:
 Worm    40 PATDEPAEPELP------RFMRNNDNYHDQRRQFVVTLSEILMVPVEKYPKYNFVGRILGPRGMT 98

  Fly   149 LRRLQEETLCKMTVLGRNSMRDRVKEEELRSSKDPKY-----------AHLNSDLHVEISTIAPP 202
            :::|::||.|::.|.||.|......|.:...| .|.:           |.....|||.|......
 Worm    99 VKQLEKETGCRIFVRGRASTTASNPESKPNKS-TPSFSKPSLSIISRNALTEEPLHVYIECQDTQ 162

  Fly   203 AEAYARIAYAMAELRKYLIP--DSNDIIRQEQLRELMDSTSLNDNDNAKSGYKKTS 256
            :.|.|::|:|:..:::.|.|  |..|.::::|   |:|.:.:|..      |:.||
 Worm   163 SAAQAKMAHAVEVIQRLLSPPKDGKDELKRQQ---LVDISLINGT------YRVTS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 7/32 (22%)
SF1_like-KH 122..237 CDD:239088 38/127 (30%)
Y69A2AR.32NP_741340.2 SF1_like-KH 72..206 CDD:239088 41/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.