DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and gld-1

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_492143.1 Gene:gld-1 / 172532 WormBaseID:WBGene00001595 Length:463 Species:Caenorhabditis elegans


Alignment Length:183 Identity:56/183 - (30%)
Similarity:103/183 - (56%) Gaps:15/183 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EKANEYIRDCMAERNRM---DRKFPIAEKLLEGEIEKVQTTGRIPSREQKYADIYREKP----LR 120
            |...||:.|.:.|:..:   ...|...|:||:.||.:|    |:...:.::..:...:|    :.
 Worm   144 EATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRV----RVALFQTEFPRVELPEPAGDMIS 204

  Fly   121 ISQRVLVPIREHPKFNFVGKLLGPKGNSLRRLQEETLCKMTVLGRNSMRDRVKEEELRSSKDPKY 185
            |::::.||..|:|.:||||::|||:|.:.::|:::|.||:.|.|:.||||:.||...|...:  :
 Worm   205 ITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKAN--W 267

  Fly   186 AHLNSDLHVEISTIAPPAEAYARIAYAMAELRKYLI--PDSNDIIRQEQLREL 236
            .||..||||.:.........:.::..|:.:::|.||  |:..|.::::||.||
 Worm   268 EHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMEL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 11/51 (22%)
SF1_like-KH 122..237 CDD:239088 41/117 (35%)
gld-1NP_492143.1 STAR_dimer 144..190 CDD:293152 13/49 (27%)
SF1_like-KH 206..328 CDD:239088 41/117 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S2169
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.