DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and khdrbs3

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_009296555.1 Gene:khdrbs3 / 101867535 ZFINID:ZDB-GENE-130530-892 Length:305 Species:Danio rerio


Alignment Length:272 Identity:111/272 - (40%)
Similarity:142/272 - (52%) Gaps:48/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 REHPKFNFVGKLLGPKGNSLRRLQEETLCKMTVLGRNSMRDRVKEEELRSSKDPKYAHLNSDLHV 194
            ::..:||||||||||:||||:||||:||.||::||:.||||:.||||||.|.:.||.|||.||||
Zfish    29 QQQTQFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKEKEEELRKSGETKYHHLNEDLHV 93

  Fly   195 EISTIAPPAEAYARIAYAMAELRKYLIPDSNDIIRQEQLRELMDSTSLN-DNDNAKSGYKKTSHM 258
            .|...|||||||||:.:|:.|::|:||||.||.|||.||:||   |.|| .:::||....:....
Zfish    94 LIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQEL---TYLNGGSEDAKVPAARGKTT 155

  Fly   259 QGGNNVLGGGSINPIGGVKNTPHHSYRSSQPSSFSKNVLAPKQKVMSILEKARTA---------- 313
            ..|......|:....|||........|.:.|.....:.:...:.|.....:||.|          
Zfish   156 TRGRGTSAPGTHRTRGGVPPPQAAVPRGAAPRGAPPSRVPSSRGVAVSSRRARGAPPPPGYRPPP 220

  Fly   314 --MDETYGR-GYDDGLG--YDPHQSYDS---------------YSYGTHG-----HGPH------ 347
              :.:|||. .||||.|  || .|.|||               |.||..|     :||.      
Zfish   221 AVVQDTYGEYEYDDGYGTAYD-DQGYDSYDNNYNNQAQNSDDYYEYGISGDSYDSYGPEEWTNNR 284

  Fly   348 --GPPANILGGV 357
              .|||....||
Zfish   285 NKAPPARTSKGV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891
SF1_like-KH 122..237 CDD:239088 69/106 (65%)
khdrbs3XP_009296555.1 SF1_like-KH 34..141 CDD:239088 73/109 (67%)
Sam68-YY 227..279 CDD:293176 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4780
Inparanoid 1 1.050 190 1.000 Inparanoid score I3866
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1163
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.