DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and qkib

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_021336383.1 Gene:qkib / 100462714 ZFINID:ZDB-GENE-081028-54 Length:176 Species:Danio rerio


Alignment Length:183 Identity:58/183 - (31%)
Similarity:94/183 - (51%) Gaps:33/183 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GNVQINEKAN---EYIRDCMAERNRMDRK------FPIAEKLLEGEIEKVQTTGRIPSREQKYAD 112
            |.::..||..   :|:...|.::..|...      |...|:||:.||.:|        |:..|.|
Zfish     3 GEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRV--------RKDMYND 59

  Fly   113 IYR--------EKP------LRISQRVLVPIREHPKFNFVGKLLGPKGNSLRRLQEETLCKMTVL 163
            ...        |.|      :::.:::.||::|:|.|||||::|||:|.:.::|:.||.||:.|.
Zfish    60 TLNGSTEKRSSELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVR 124

  Fly   164 GRNSMRDRVKEEELRSSKDPKYAHLNSDLHVEISTIAPPAEAYARIAYAMAEL 216
            |:.||||:.|||:.|..  |.:.|||.||||.|:.......|..::..|:.|:
Zfish   125 GKGSMRDKKKEEQNRGK--PNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 13/62 (21%)
SF1_like-KH 122..237 CDD:239088 40/95 (42%)
qkibXP_021336383.1 STAR_dimer 10..68 CDD:318695 14/65 (22%)
SF1_like-KH 83..>175 CDD:239088 39/93 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.